DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and MRPL16

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_009515.1 Gene:MRPL16 / 852242 SGDID:S000000134 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:43/176 - (24%)
Similarity:67/176 - (38%) Gaps:48/176 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RRVKEQKKSYAELRKAYKEFQKN---FRTDGELIVQLIDQFRNFSRTPLESEMRSKLDCLENLEY 172
            ||.|.:   ||...|..::.||.   .||.|.:....: ||..:.       :|.|.:.:.....
Yeast    35 RRFKHE---YAPRFKIVQKKQKGRVPVRTGGSIKGSTL-QFGKYG-------LRLKSEGIRISAQ 88

  Fly   173 LLHQIDNALMF----IDNGGL-----DDVLLPIVVNDTSTS----------LRVSAMRVLGSLAS 218
            .|.:.|||:|.    ::||.|     .:|.:.|..|:|...          :||...::|..:  
Yeast    89 QLKEADNAIMRYVRPLNNGHLWRRLCTNVAVCIKGNETRMGKGKGGFDHWMVRVPTGKILFEI-- 151

  Fly   219 NNPKAQIKVFEKNF---GSHLAQI-----LTSSGNVGEISAALHAF 256
            |......||..:.|   |:.|..:     |.|...||     ||:|
Yeast   152 NGDDLHEKVAREAFRKAGTKLPGVYEFVSLDSLVRVG-----LHSF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 28/117 (24%)
MRPL16NP_009515.1 Ribosomal_L16_L10e 42..174 CDD:412329 32/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.