DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and SAG24

DIOPT Version :10

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_564878.1 Gene:SAG24 / 842976 AraportID:AT1G66580 Length:221 Species:Arabidopsis thaliana


Alignment Length:37 Identity:9/37 - (24%)
Similarity:16/37 - (43%) Gaps:6/37 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 FSKTKYPRP------RHFGDANLAPPILFSSDTGIPL 281
            |..|:...|      :||.|.....|::...:.|:|:
plant    48 FGGTREGAPDVKIWLQHFKDGQWDSPVIVDEEPGVPM 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:407047 9/37 (24%)
SAG24NP_564878.1 PTZ00173 1..211 CDD:185498 9/37 (24%)

Return to query results.
Submit another query.