DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and Fes1C

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001332564.1 Gene:Fes1C / 831805 AraportID:AT5G02150 Length:324 Species:Arabidopsis thaliana


Alignment Length:208 Identity:50/208 - (24%)
Similarity:93/208 - (44%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ELRKAYKEFQKNFRTDGELIVQLIDQFRNFSRTP---LESEMRSKLD---CLENLEYLLHQIDNA 180
            |.||.:.|..::...|   :|:.:.:.....:||   ||:...:..|   .|:.|:..:..||.|
plant    31 EDRKWFAEAMQSQTVD---VVKRLKEITQVLQTPQQVLEAHEVTPQDIEGLLDELQEHVESIDMA 92

  Fly   181 LMFIDNGGLDDVLLPIV--VNDTSTSLRVSAMRVLGSLASNNPKAQIKVFEKNFGSHLAQILTSS 243
            ......||    |:|::  :.:::.::|..:..|:.::..|||::|..|.|.|....|....||.
plant    93 NDLHSVGG----LVPLLGYLKNSNANIRAKSADVVSTIVENNPRSQESVMEANGLESLLLRFTSD 153

  Fly   244 GNVGEISAALHAFGALLRK-------FPLAQQRVLSTSGTQALIKVLQSPDVELRSKAKVVTLIS 301
            .::...:.||.|..:|:|.       |.:|       :|...|...|::..|..:.||  :.|:.
plant   154 TDMHSRTQALGAISSLIRNNKPGITGFRIA-------NGYSGLKDALETDSVRFQRKA--LNLLH 209

  Fly   302 DLVLEKRSVLDVS 314
            .|:.|..|..|::
plant   210 YLLQENDSDSDIA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 39/157 (25%)
Fes1CNP_001332564.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.