DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and Fes1B

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_190948.1 Gene:Fes1B / 824547 AraportID:AT3G53800 Length:363 Species:Arabidopsis thaliana


Alignment Length:371 Identity:80/371 - (21%)
Similarity:132/371 - (35%) Gaps:108/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SHDDNEPLALDYKPDIIEESIRRVKEQKKSYAELRKAYKEFQKNFRTDGELIVQLIDQFRNFSRT 154
            ||.|.            ..|..|:.|:.:.:      :.|..:....|....:::|.|.......
plant    17 SHSDG------------ASSSSRISEEDRQW------FVEAMQAHTIDSISRMKVISQIMKMPEQ 63

  Fly   155 PLESEMRSKLDCLENLEYLLHQIDNALMFID-------NGGLDDVLLPIV--VNDTSTSLRVSAM 210
            .||::..:.    ::||.:|.::...:..||       .||    |:|::  :.:::..:|..:.
plant    64 VLEAQGVTP----DDLEGMLAELQEHVESIDLANDLHSIGG----LVPLLSYLKNSNAKIRAKSA 120

  Fly   211 RVLGSLASNNPKAQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRK-------FPLAQQ 268
            .||.::..|||::|..|.|.|....|.....:..::...:.||.|..:|:|.       |.||  
plant   121 DVLTTVVQNNPRSQQLVMEANGFEPLLTNFIADPDIRVRTKALGAISSLIRNNQPGITAFRLA-- 183

  Fly   269 RVLSTSGTQALIKVLQSPDVELRSKAKVVTLISDLVLEKRSVLDVSKD--DPEASSTMAQYVLLD 331
                 :|...|...|.|..|..:.||  :.|:..|:.|..|...:.:|  .|.....:|..  .|
plant   184 -----NGYAGLRDALVSDTVRFQRKA--LNLLHYLLQESNSDCKIVRDLGFPRIMIHLASN--QD 239

  Fly   332 FESWLKTPGYCAAVDTVLTKEF----LLLLEQPEVVE-------QFATALE---------TTEDM 376
            ||                .:||    ||.|.:.|.|.       .....||         :.||:
plant   240 FE----------------VREFALRGLLELAREESVRNLDRGDVNLRQLLEERTRRIIVMSDEDL 288

  Fly   377 CT---------STWS----QSSGLRHALLTVRNRYANSTDEYRLEV 409
            |.         |.|:    :.|.||...|.    |..|.||...:|
plant   289 CAAREERQLVDSLWTVCYDEPSLLRERGLV----YLPSDDELAPDV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 41/176 (23%)
Fes1BNP_190948.1 Fes1 9..95 CDD:400776 17/99 (17%)
armadillo repeat 102..126 CDD:293788 4/23 (17%)
armadillo repeat 134..171 CDD:293788 9/36 (25%)
armadillo repeat 177..211 CDD:293788 11/42 (26%)
armadillo repeat 219..250 CDD:293788 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.