DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and AT3G51980

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_190766.1 Gene:AT3G51980 / 824361 AraportID:AT3G51980 Length:382 Species:Arabidopsis thaliana


Alignment Length:367 Identity:91/367 - (24%)
Similarity:154/367 - (41%) Gaps:51/367 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RINLQTGLKEAKLLDESE----RGTSLQSQPDDQNARESHDDNEPLALDYK-PDIIEESIRRVKE 115
            ::|...|:..:.:.||:|    .|..:..|........|.|.....|:.:. |..::|:.:  ..
plant    26 KVNSSGGMVWSSVRDEAELVEDSGVVIGEQDQIDGGFSSLDGMLHWAIGHSDPATLKEAAK--DA 88

  Fly   116 QKKSYAELRKAYKEFQK-----NFRTDGELIVQLIDQFRNFSRTPLESEMRSKLDCLENLEYLLH 175
            :|.|..||:|...|.::     ...::.:|:...||...| |...||...|:    |:.|..|:.
plant    89 EKMSLDELQKRQLELKELVEKLKMPSNAKLMQIAIDDLNN-SSLSLEDRHRA----LQELLILVE 148

  Fly   176 QIDNALMFIDNGGLDDVLLPIVVNDTSTSLRVSAMRVLGSLASNNPKAQIKVFEKNFGSHLAQIL 240
            .||||.....:|||..|...:  |...|.:|..|..|||..:.|||..|.:|.|....:.|.:::
plant   149 PIDNANDLSKSGGLRVVAGEL--NHDDTEVRKLAAWVLGKASQNNPFVQEQVLELGALTTLIKMV 211

  Fly   241 TSSGNVGEISAALHAFGALLRKFPLAQQRVLSTSGTQALIKVLQSPDVELRSKAKVVTLISDLVL 305
            .|| :..|...||.|..||:|.....|....:..|...|..|:.:..::::.:.|.|.|:.||..
plant   212 NSS-STEEAVKALFAVSALIRNNIAGQDLFFAAHGYIMLRDVMNNGSLDMKLRRKAVFLVGDLAE 275

  Fly   306 E-----KRSVLDVSKDDPEASSTMAQYVLLDFESWLKTPGYCAAVDTVLTKEFLLLLEQPEVVEQ 365
            .     ::..|.:.||.....|.:...|:||.:...|.   ..|:.|:|..:.:    :|:|:: 
plant   276 SQLQNTEKDELPIFKDRLFLKSVVDLIVVLDLDLQEKA---LTAIQTLLQLKSI----EPQVLK- 332

  Fly   366 FATALETTEDMCTSTWSQSSGLRHALLTVRNRYANS-TDEYR 406
                             :|.||..||..::.:...| .|||:
plant   333 -----------------ESCGLEEALERMKLQLEESMADEYK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 47/163 (29%)
AT3G51980NP_190766.1 Fes1 65..156 CDD:400776 25/97 (26%)
armadillo repeat 153..189 CDD:293788 12/37 (32%)
armadillo repeat 195..229 CDD:293788 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103989
Panther 1 1.100 - - LDO PTHR19316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.