DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and Fes1A

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_566349.1 Gene:Fes1A / 820091 AraportID:AT3G09350 Length:363 Species:Arabidopsis thaliana


Alignment Length:334 Identity:73/334 - (21%)
Similarity:131/334 - (39%) Gaps:88/334 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RRVKEQKKSY---------AELRKAYKEFQKNFRTDGELIVQLIDQFRNFSRTPLESEMRSKLDC 166
            |::.|:.:.:         .::.|..||.....:|..:::|:       ...||.:.:     |.
plant    26 RQLSEEDRKWFMEAMQSQTVDVVKRMKEITLVMQTPEQVLVE-------HGVTPEDIQ-----DL 78

  Fly   167 LENLEYLLHQIDNALMFIDNGGLDDVLLPIV--VNDTSTSLRVSAMRVLGSLASNNPKAQIKVFE 229
            |:.|:..:..||.|......||    |:|::  :.::..::|..|..|:.::..|||::|..|.|
plant    79 LDELQEHVESIDMANDLHSIGG----LVPLLSFLKNSHANIRAKAADVVSTIVQNNPRSQELVME 139

  Fly   230 KNFGSHLAQILTSSGNVGEISAALHAFGALLR-------KFPLAQQRVLSTSGTQALIKVLQSPD 287
            .|....|....||..::...:.||.|..:|:|       .|.||       :|...|...|.|..
plant   140 TNALESLLSNFTSDTDIHARTQALGAISSLIRHNKPGVTAFKLA-------NGYAGLRDALASDS 197

  Fly   288 VELRSKAKVVTLISDLVLE---KRSVLD-----------VSKDDPEASSTMAQYVL-LDFESWLK 337
            |..:.||  :.|:..|:.|   .||:..           .|.||.|......:.:| |..|   |
plant   198 VRFQRKA--LNLLQYLLQEDDSDRSIATGLGFPRVMMHLASSDDAEIREAALRGLLELSRE---K 257

  Fly   338 TPGYCAAVD-----------------TVLTKEFLLLLEQPEVVEQFATALETTEDMCTSTWSQSS 385
            ..| .:::|                 |::::|.|      |.|::....::....:|   :::.|
plant   258 NDG-SSSIDKSDEKLRQLLEERIKGITLMSQEDL------ETVKEERQLVDLLWSIC---YNEPS 312

  Fly   386 GLRHALLTV 394
            .||...|.|
plant   313 SLREKGLVV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 46/181 (25%)
Fes1ANP_566349.1 Fes1 9..95 CDD:400776 15/80 (19%)
SRP1 36..>248 CDD:227396 54/236 (23%)
armadillo repeat 102..126 CDD:293788 4/23 (17%)
armadillo repeat 134..171 CDD:293788 11/36 (31%)
armadillo repeat 177..211 CDD:293788 11/42 (26%)
armadillo repeat 219..250 CDD:293788 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.