DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and MRPL16

DIOPT Version :10

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_060310.1 Gene:MRPL16 / 54948 HGNCID:14476 Length:251 Species:Homo sapiens


Alignment Length:81 Identity:19/81 - (23%)
Similarity:37/81 - (45%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ALLRKFPLAQQRVL--STSGTQALIKVLQSPDVELRSKAKV-----VTLISDLVLEKRSVLDVSK 315
            |.|.:.||:....|  :::|.:.|:.|....||.:..|.|:     ..|:..:..|.:::.|:..
Human    10 APLLRVPLSDSWALLPASAGVKTLLPVPSFEDVSIPEKPKLRFIERAPLVPKVRREPKNLSDIRG 74

  Fly   316 DDPEASS-TMAQYVLL 330
            ...||:. |...:.:|
Human    75 PSTEATEFTEGNFAIL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:407047 18/75 (24%)
MRPL16NP_060310.1 Ribosomal_L16 60..190 CDD:459733 6/31 (19%)

Return to query results.
Submit another query.