DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and hspbp1

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001016069.1 Gene:hspbp1 / 548823 XenbaseID:XB-GENE-1007205 Length:325 Species:Xenopus tropicalis


Alignment Length:361 Identity:83/361 - (22%)
Similarity:134/361 - (37%) Gaps:89/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IAEGQAIPRGLHVRINLQTGLKEAKLLDESERGTSLQSQPDDQNARESHDDNEPLALDYKPDIIE 107
            :|:|:......| |.||| ||.:..:    |.||...|.|          ..||::         
 Frog     1 MADGEQDGHRPH-RQNLQ-GLLQMAI----EAGTESDSTP----------QMEPMS--------- 40

  Fly   108 ESIRRVKEQKKSYAELRKAYKEFQKNFRTDGELIVQLIDQFRNFSRTPLESEMRSKLDCLENLEY 172
                   |:::.:  |::|..........:.::|.:.:.:..|.:.:..|.:.:.:  .||.|..
 Frog    41 -------EERRQW--LQQAMNSAFSGQADEVKMIKECLQELSNETNSGEEEDGKER--ALELLAD 94

  Fly   173 LLHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRVSAMRVLGSLASNNPKAQIKVFEKNFGSHLA 237
            |...:|||..|...||: |:||...||.....||.....::|..:.|.|..|...........|.
 Frog    95 LCDNLDNASDFCKLGGM-DLLLSRYVNCPEAELRWRCADLIGICSQNVPFVQEMALRSGAVKILL 158

  Fly   238 QILTSSGNVGEISAALHAFGALLRKFPLAQQRVLSTSGTQALIKVLQSPDVELRSKAKVVTLISD 302
            |:|....|......||.|...|:|:........|...|...|::.:|| ||: :.|.|...|:.:
 Frog   159 QLLDLDPNDQVRIKALFAISCLVREQEEGLTDFLKQDGFSVLMRAMQS-DVQ-KLKIKSAFLLQN 221

  Fly   303 LVL---EKRSVL-----------------------------DVSKDDPEASSTMAQYVLLDFESW 335
            |::   |.:..|                             ::..|.|:|.|. .|.:.|.||.:
 Frog   222 LLMSHPEHKGTLCSMGMVTQLVSLLHTDHSPFHEHVLGALCNLVTDFPQAVSE-CQALELGFEEF 285

  Fly   336 LKTPGYCAAVDTVLTKEFLLLLEQPEVVEQFATALE 371
            |              ||..|||::.   |:|...||
 Frog   286 L--------------KERCLLLDKK---EEFQEELE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 47/190 (25%)
hspbp1NP_001016069.1 Fes1 16..104 CDD:369996 24/122 (20%)
armadillo repeat 60..95 CDD:293788 6/36 (17%)
armadillo repeat 102..139 CDD:293788 12/37 (32%)
armadillo repeat 145..180 CDD:293788 8/34 (24%)
armadillo repeat 188..224 CDD:293788 11/37 (30%)
armadillo repeat 230..264 CDD:293788 1/33 (3%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R442
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.