DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and RpL10

DIOPT Version :10

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_651954.3 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:57/153 - (37%) Gaps:61/153 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VATDEWQTIAEGQAIPRG----------------------LH----VRIN----------LQTGL 63
            :.:||::.:: .:|:..|                      ||    :|||          ||||:
  Fly    52 LVSDEYEQLS-SEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGM 115

  Fly    64 KEAKLLDESERGTSLQ---SQPDDQNARESHDDNEPLALDYKPDIIEESIRRVK----EQKKSYA 121
            :.|   ....:||..:   .|| ..:.|.|.        .||..:| |::||.|    .::|.|.
  Fly   116 RGA---FGKPQGTVARVRIGQP-IMSVRSSD--------RYKAQVI-EALRRAKFKFPGRQKIYV 167

  Fly   122 ELRKAYKEFQK----NFRTDGEL 140
            ..:..:.::::    ..|.|..|
  Fly   168 SKKWGFTKYERERYEELRDDNRL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:407047
RpL10NP_651954.3 PTZ00173 1..213 CDD:185498 32/153 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.