DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and CG10973

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001034002.1 Gene:CG10973 / 39447 FlyBaseID:FBgn0036306 Length:306 Species:Drosophila melanogaster


Alignment Length:275 Identity:69/275 - (25%)
Similarity:114/275 - (41%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LESEMRSKLDCLENLEYL---LHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRVSAMRVLGSLA 217
            |.||..|..|.:|:|:.:   :..||||:..:..||...:|..|..:|  :.:|.||:..:..:|
  Fly    67 LNSEESSTDDQIESLDVIRSHIDDIDNAITLVKLGGTATLLRYITHSD--SEVRESALNTVAEVA 129

  Fly   218 SNNPKAQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPLAQQRVLSTSGTQALIKV 282
            .||...|..:....|...||:.|:.| |...:..:|:|..:|:|.|...........|.::||..
  Fly   130 QNNVFCQNALINDKFLPALAKNLSHS-NPNTVRCSLYAISSLIRNFQPGYDEFKRIKGIRSLIPC 193

  Fly   283 LQSPDVELRSKAKVVTLISDLVLEKRSVLDVSKDDPEASSTMAQYVLLDFESWLKTPGYCAAVDT 347
            |:|.:..:  ..|...||:.|...::||.|                                 |.
  Fly   194 LKSTNTNV--YVKTAFLIASLTSIEKSVRD---------------------------------DF 223

  Fly   348 VLTKEFLLLLEQPEVVEQFATALETTEDMCTSTWSQSSGLRHALLTVRNRYANSTDEYRLEVSQI 412
            |..:.|.:|:|..:.|:.|....|||. ...|:.|:.|.|:   |:...|     :|...::.||
  Fly   224 VKEEVFPVLVENLKPVDDFDIKQETTL-FALSSLSRESELK---LSTEKR-----EEILSKLQQI 279

  Fly   413 LAK-----LCERLFN 422
            ::|     .||.:.|
  Fly   280 ISKNKQSETCEDMVN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 41/161 (25%)
CG10973NP_001034002.1 Fes1 13..94 CDD:285773 9/26 (35%)
ARM <92..172 CDD:237987 24/82 (29%)
armadillo repeat 97..128 CDD:293788 8/32 (25%)
HEAT_2 <104..171 CDD:290374 18/69 (26%)
armadillo repeat 136..172 CDD:293788 10/36 (28%)
ARM 138..258 CDD:237987 34/156 (22%)
armadillo repeat 178..209 CDD:293788 6/32 (19%)
HEAT repeat 227..257 CDD:293787 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19316
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R442
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.