DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and hspbp1

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_956369.1 Gene:hspbp1 / 338155 ZFINID:ZDB-GENE-030219-55 Length:333 Species:Danio rerio


Alignment Length:344 Identity:78/344 - (22%)
Similarity:136/344 - (39%) Gaps:46/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LQSQPDDQNARESHDDNEPLALDYKPDIIEESIRRVKEQKKSYAELRKAYKEFQKNFRTDGELIV 142
            ||...:..:|.:.....||:..: :.|.:..::..|.:.:....|..|...|..|   |||    
Zfish    18 LQMAVEAGSASDGPAPLEPMTQE-RMDFLRGALSEVCKGQMDEVEQMKRCLEVLK---TDG---- 74

  Fly   143 QLIDQFRNFSRTPLESEMRSKLDCLENLEYLLHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRV 207
               .:.|.......|.|...:.:.||.|..|...:|||...:..||| |:.|...:..|.|.:|.
Zfish    75 ---CKDREVEGEEEEEEDDEREEALEMLSELCENLDNARDLMKLGGL-DLCLSRCLCHTETGIRW 135

  Fly   208 SAMRVLGSLASNNPKAQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPLAQQRVLS 272
            .|.:::.|.|.|.|:.|..:..:.....|.|:..:..:......||:|...|:|:.....:..||
Zfish   136 RAAQLIASSAQNMPEVQFYLLNQGALLTLLQLADNDPHSTVRVKALYAVSCLVREQEAGLKDFLS 200

  Fly   273 TSGTQALIKVLQSPDVELRSKAKVVTLISDLVLEKRSVLDVSKDDPEASST-MAQYVLLDFESWL 336
            ..|...|::.:||...:||:|:..:            :|::....||...| ::..::....|.|
Zfish   201 HDGFSVLMRGMQSDSEKLRTKSAFL------------LLNLLNSHPEHKDTVLSMGMVQQLVSVL 253

  Fly   337 KTPGYCAAVDTVLTKEFLLLLEQPEVVEQFATALETTEDMCTSTWSQSSGLRHALLTVRNRYANS 401
            ::| :.:..:.||.....|:.:.|..:..           |.   ..|.||.. ||..|.:....
Zfish   254 RSP-HSSVHEHVLGALCCLVEDSPRGMSD-----------CR---DPSLGLEE-LLKQRVQDLRG 302

  Fly   402 TDEYRLEVSQILAKLCERL 420
            .:|...|:     :.||||
Zfish   303 QEESLEEL-----EFCERL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 41/159 (26%)
hspbp1NP_956369.1 Fes1 14..112 CDD:285773 24/104 (23%)
armadillo repeat 109..146 CDD:293788 11/37 (30%)
ARM 154..273 CDD:237987 26/131 (20%)
armadillo repeat 155..187 CDD:293788 5/31 (16%)
armadillo repeat 195..231 CDD:293788 10/47 (21%)
armadillo repeat 237..271 CDD:293788 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.