powered by:
Protein Alignment Sil1 and Rpl10l
DIOPT Version :9
Sequence 1: | NP_651356.1 |
Gene: | Sil1 / 43034 |
FlyBaseID: | FBgn0039296 |
Length: | 429 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003750221.1 |
Gene: | Rpl10l / 299106 |
RGDID: | 1305913 |
Length: | 214 |
Species: | Rattus norvegicus |
Alignment Length: | 35 |
Identity: | 8/35 - (22%) |
Similarity: | 12/35 - (34%) |
Gaps: | 20/35 - (57%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 GLHVRI--------------------NLQTGLKEA 66
|.|:|: .||||::.|
Rat 84 GFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGA 118
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Sil1 | NP_651356.1 |
SIL1 |
167..>326 |
CDD:374797 |
|
Rpl10l | XP_003750221.1 |
PTZ00173 |
1..209 |
CDD:185498 |
8/35 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0197 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.