DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and HSPBP1

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_005258757.1 Gene:HSPBP1 / 23640 HGNCID:24989 Length:431 Species:Homo sapiens


Alignment Length:294 Identity:61/294 - (20%)
Similarity:98/294 - (33%) Gaps:67/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DESERGTSL-------------------QSQPDDQNARESHD------------DNEPLALDYKP 103
            ||..||:.|                   .|.....|:|...:            ..||   |..|
Human     3 DEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEP---DPPP 64

  Fly   104 DIIEESIRRVKEQKKSYAELRKAYKEFQKNFRTDGELIVQLIDQFRNFSR--TPLESEMRSKLD- 165
            :.:.|..|:..::..|.|            ||...|.:.|:....|..|:  .|...|.....| 
Human    65 EPMSEERRQWLQEAMSAA------------FRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQ 117

  Fly   166 -----CLENLEYLLHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRVSAMRVLGSLASNNPKAQI 225
                 .||.|..|...:|||..|....|: .:|:...:...:..||..|.:::|:.:.|....|.
Human   118 QEREGALELLADLCENMDNAADFCQLSGM-HLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQE 181

  Fly   226 KVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPLAQQRVLSTSGTQALIKVLQSPDVEL 290
            :|........|.::|...........||.|...|:|:......:.|...|...|::.:|....:|
Human   182 QVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKL 246

  Fly   291 RSKAKVVTLISDLVLEKRSVLDVSKDDPEASSTM 324
              |.|...|:.:|::          ..||...|:
Human   247 --KVKSAFLLQNLLV----------GHPEHKGTL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 36/158 (23%)
HSPBP1XP_005258757.1 Fes1 45..139 CDD:312204 24/108 (22%)
armadillo repeat 88..130 CDD:293788 10/41 (24%)
armadillo repeat 137..174 CDD:293788 8/37 (22%)
armadillo repeat 180..215 CDD:293788 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R442
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.