DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and RPL10L

DIOPT Version :10

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_542784.1 Gene:RPL10L / 140801 HGNCID:17976 Length:214 Species:Homo sapiens


Alignment Length:87 Identity:18/87 - (20%)
Similarity:28/87 - (32%) Gaps:31/87 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NKTNDFVATDEWQTIAEGQ-AIPRGLHVRINLQTGLKEAKLLDESERGTSLQSQPDDQNARESHD 92
            ||.......|..||...|. ..|:|...|:::...:...:        |.||:        |.| 
Human   100 NKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIR--------TKLQN--------EEH- 147

  Fly    93 DNEPLALDYKPDIIEESIRRVK 114
                         :.|::||.|
Human   148 -------------VIEALRRAK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:407047
RPL10LNP_542784.1 PTZ00173 1..209 CDD:185498 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.