DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and Rpl10

DIOPT Version :10

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_443067.1 Gene:Rpl10 / 110954 MGIID:105943 Length:214 Species:Mus musculus


Alignment Length:81 Identity:20/81 - (24%)
Similarity:31/81 - (38%) Gaps:20/81 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 HLAQILTSSGNVGEISAALHAFGALLR---KFPLAQQRVLSTSGTQALIKVLQSPDVELRSKAKV 296
            |:.|::.|...  ::....|...||.|   |||..|:  :..|......| ..:.:.|       
Mouse   130 HIGQVIMSIRT--KLQNKEHVIEALRRAKFKFPGRQK--IHISKKWGFTK-FNADEFE------- 182

  Fly   297 VTLISDLVLEKRSVLD 312
                 |:|.|||.:.|
Mouse   183 -----DMVAEKRLIPD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:407047 20/81 (25%)
Rpl10NP_443067.1 PTZ00173 1..209 CDD:185498 20/81 (25%)

Return to query results.
Submit another query.