DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and Rpl10

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_443067.1 Gene:Rpl10 / 110954 MGIID:105943 Length:214 Species:Mus musculus


Alignment Length:81 Identity:20/81 - (24%)
Similarity:31/81 - (38%) Gaps:20/81 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 HLAQILTSSGNVGEISAALHAFGALLR---KFPLAQQRVLSTSGTQALIKVLQSPDVELRSKAKV 296
            |:.|::.|...  ::....|...||.|   |||..|:  :..|......| ..:.:.|       
Mouse   130 HIGQVIMSIRT--KLQNKEHVIEALRRAKFKFPGRQK--IHISKKWGFTK-FNADEFE------- 182

  Fly   297 VTLISDLVLEKRSVLD 312
                 |:|.|||.:.|
Mouse   183 -----DMVAEKRLIPD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 20/81 (25%)
Rpl10NP_443067.1 PTZ00173 1..209 CDD:185498 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.