DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and Pcdhb5

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_444360.1 Gene:Pcdhb5 / 93876 MGIID:2136739 Length:792 Species:Mus musculus


Alignment Length:579 Identity:143/579 - (24%)
Similarity:231/579 - (39%) Gaps:133/579 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SFLA--TEDLAVGSIIGKL-----RINGD-------ANAETGDINLSLREKNAPVEIHPGTKELA 91
            ||:|  .:||.:|:  |:|     |:..|       .::||||  |.||||              
Mouse    42 SFVAHLAKDLGLGA--GELAARSARVVSDHDKQQFILDSETGD--LLLREK-------------- 88

  Fly    92 LSVELDKEGVRG---PSSIYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAPQWIGTPYTLTLSEV 153
                ||:|.:.|   |..::..|...:     |.......:.:.|:|||:|::......|.:.|.
Mouse    89 ----LDREELCGSVDPCVLHFQVFLEK-----PVQFFQGELLIQDINDNSPEFPDKELLLKILEN 144

  Fly   154 TVPGTRILQGARAEDADQPGPFSTVEYQVLPGPYSEYVQFLNPLEG----TLVLKKALDYEQLQN 214
            :.|||| .....|:|.| .|.....:|.|.|..:. :|...|..||    .||..:|||.|:...
Mouse   145 SQPGTR-FSLKLAQDLD-VGSNGLQQYTVNPNSHF-HVLTRNNSEGKKYPELVQDRALDREEQAE 206

  Fly   215 FTVKLRAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPGELRMRPEPLKAV-- 277
            .::.|.|.|.|:|||....|:|::|.|.:|..|:|....|..::.....|      ..|:..|  
Mouse   207 LSLILTALDGGSPPRSGTALVRILIMDINDNAPEFVNNPYEVQVLESSPP------DSPVLTVFA 265

  Fly   278 -DQDEGICAPIQYTIVQSQD--AKYFRIHPHNGAISLLTPIGY---------ADVANGATLVVKA 330
             |.|.|....:.|.:.|:.|  .|.|.|:...|.|.|.|.:.:         .:..:|..|..|.
Mouse   266 QDADAGNFGRVSYGLFQASDEIQKTFSINEFTGEIRLKTKLDFEKTKSYHVEIEATDGGGLSGKG 330

  Fly   331 TQI-------DNPDRYALTTVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAVGNRILALPTNKPG 388
            :.:       ||.....::::..:.| .:|..:.:|.::    :|.|:....|..|.::     .
Mouse   331 SVVIEVLDVNDNAPELTISSLTSSVP-ENSPETVVAIIR----IRDRDSGENGKMICSI-----S 385

  Fly   389 KHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATD-GMTNSTAE--LTLEVIDV 450
            .|:.::: .|....|::      ||...|||.|...::...:..:| |....|.:  :|::|.|:
Mouse   386 DHVPFIL-KPSYKNFYT------LVTESPLDRESRAEYNITITVSDLGTPRLTTQHTITVKVSDI 443

  Fly   451 NDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGD--RNDKLELSLRGQHAGLFEIDS 513
            ||..|.|.:|.|...|       |.::...:.||.:.|.|.|  .|..:..||...|.....:.|
Mouse   444 NDNAPAFSQTSYTMFV-------RENNSPALHIGTISATDSDSGSNAHITYSLLPPHDQQLALHS 501

  Fly   514 TGNIYMRPEQLQSLNESTVHLIAI----------------ATDTGVPPRSTSVPVSVTM 556
                      |.|:|.....|.|:                |||.|.|..|:...|.|.:
Mouse   502 ----------LISINADNGQLFALSALDYEALQGFEFYVGATDRGSPELSSQALVRVVV 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 25/105 (24%)
Cadherin_repeat 145..244 CDD:206637 34/102 (33%)
Cadherin_repeat 253..347 CDD:206637 22/114 (19%)
Cadherin_repeat 365..452 CDD:206637 19/89 (21%)
Cadherin_repeat 461..555 CDD:206637 25/111 (23%)
Pcdhb5NP_444360.1 Cadherin_2 29..111 CDD:285466 25/90 (28%)
Cadherin_repeat 139..237 CDD:206637 34/100 (34%)
Cadherin_repeat 245..342 CDD:206637 20/102 (20%)
Cadherin_repeat 354..446 CDD:206637 23/108 (21%)
Cadherin_repeat 454..556 CDD:206637 26/114 (23%)
Cadherin_repeat 575..663 CDD:206637
Cadherin_C_2 687..769 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.