DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and Cdhr3

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001019649.1 Gene:Cdhr3 / 68764 MGIID:1916014 Length:831 Species:Mus musculus


Alignment Length:506 Identity:120/506 - (23%)
Similarity:193/506 - (38%) Gaps:119/506 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FLATE-DLAVG----SIIGKLRINGDANAETG------DINLSLREKNAPVEIHPGTKELAL--- 92
            |..|| |...|    :::..:|.:|:..|.|.      :||.......:|..::...:|:.|   
Mouse   190 FSTTELDFEAGHKSFNLLVGVRDSGNLEASTALQVTIVNINDETPRFTSPRRVYSVPEEVPLGTM 254

  Fly    93 -----SVELDKEGVRG--------PSSIYV------NVICIRRHSTD-------PSFVIPVNVR- 130
                 :::.|.||..|        .||.::      .:...||...|       |...:.|.|| 
Mouse   255 VANITAMDPDDEGFPGRLLYSITTTSSYFMVDQLTGTIQVARRLDRDAGELRQNPIISLEVRVRD 319

  Fly   131 ---------------VTDVNDNAPQWIGTPYTLTLSEVTVPGTRILQ-GARAEDADQPGPFSTVE 179
                           |.|:|||........:::.|.|.|..||.:|. .....|.|...|.:...
Mouse   320 RPSGGQENRMQITFIVEDINDNPATCRKLTFSIMLPERTANGTLLLDLNKFCFDDDSEAPNNKFN 384

  Fly   180 YQVLPGPYSEYVQFLNPL-EGTLVLKKALDYEQLQN------FTVKLRAQDQGTPPRHSDTLLRV 237
            :....|..|......:|. .|.:||...||||...|      :.|.::.|| ..||.:..::...
Mouse   385 FTTPSGAGSSRRFSQHPAGSGRIVLTGDLDYENPSNLAVGNVYNVMIQVQD-AAPPYYKKSIYIS 448

  Fly   238 VITDADDQNPK-FQRESYSAEIPADGRPGELRMRPEPLKAVDQDEGICAPIQYTIVQS----QDA 297
            ::|..:::.|. |:|.||..::| :.||.  |.:...::|.|.|.. ..|:.|::.:.    |..
Mouse   449 ILTRPENEFPLIFERPSYVFDVP-ERRPA--RTQIGQVRATDADFP-RTPVVYSVSRGGSSLQYP 509

  Fly   298 KYFRIHPHNGAISLLTPIGYADVANGATLVVKATQIDNPDRYALT-TVQLTRPGSHSDLSTLAFV 361
            ..|.|:|..|.:.|:|...: :..:...|.|:||  :..||.::| ||.:........:.|..| 
Mouse   510 NIFWINPKTGELQLITQADH-ETTSVYILTVEAT--NGEDRSSVTVTVNILGENDEKPVCTPNF- 570

  Fly   362 QKRFVMRIREDTAVGNRILALPTNKPGKHLKYVIPDPVNSQF-FSVGS----------------L 409
               :.|.|..|..||       ||.....|.....|...|.| :|:||                :
Mouse   571 ---YFMAIPVDLKVG-------TNIQNFKLTCTDLDSSPSSFRYSIGSGNINNHFTFSPNAGSNI 625

  Fly   410 GELVLAKPLDYEKM-TKHEFQVLA--TD-----GMTNS-----TAELTLEV 447
            ..|:||...||..: |..::|:|.  ||     |.|.:     |..:||.|
Mouse   626 TRLLLASRFDYSSLDTVWDYQLLVHITDDNLLSGSTKAKALVETGTVTLSV 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 28/146 (19%)
Cadherin_repeat 145..244 CDD:206637 26/106 (25%)
Cadherin_repeat 253..347 CDD:206637 27/98 (28%)
Cadherin_repeat 365..452 CDD:206637 30/113 (27%)
Cadherin_repeat 461..555 CDD:206637
Cdhr3NP_001019649.1 Cadherin_repeat 30..128 CDD:206637
Cadherin_repeat 141..231 CDD:206637 10/40 (25%)
Cadherin_repeat 242..341 CDD:206637 18/98 (18%)
Cadherin_repeat 349..456 CDD:206637 26/107 (24%)
Cadherin_repeat 465..561 CDD:206637 27/102 (26%)
Cadherin_repeat 571..679 CDD:206637 30/113 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 743..763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 798..831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24028
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.