DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and PCDHA11

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_061725.1 Gene:PCDHA11 / 56138 HGNCID:8665 Length:949 Species:Homo sapiens


Alignment Length:577 Identity:142/577 - (24%)
Similarity:243/577 - (42%) Gaps:101/577 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YLEGGGSAESFLATEDLAVGSIIGKLRINGDANAETGDI-----NLSLREKNAPVEIHPGTKELA 91
            :.|.|.....:..:|:...|:.:|  ||..|...|..::     .::.:.....:|::.....|.
Human    23 FWEVGSGQLHYSVSEEAKHGTFVG--RIAQDLGLELAELVQRLFRVASKTHGDLLEVNLQNGILF 85

  Fly    92 LSVELDKEGVRGPS---SIYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAPQWIGTPYTLTLSEV 153
            ::..:|:|.:.|.|   ||::.||..|     |..|..|||.|.|:|||.|.:......|.::|.
Human    86 VNSRIDREELCGQSAECSIHLEVIVDR-----PLQVFHVNVEVKDINDNPPVFSLREQKLLIAES 145

  Fly   154 TVPGTRI-LQGARAEDADQPGPFSTVEYQVLPGPYSEYVQFLNPLEG------TLVLKKALDYEQ 211
            ....:|. |:||...|.::.   :.:.|::   ..:||....:|..|      :|:|||:||.|:
Human   146 KQSDSRFPLEGASDADIEEN---ALLTYRL---SKNEYFSLDSPTNGKQIKRLSLILKKSLDREK 204

  Fly   212 LQNFTVKLRAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPGELRMRPEPLKA 276
            .....:.|.|.|.|.|.......|.|.:.|.:|.:|:|.:..|...:..:.....|.::   |.|
Human   205 TPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLK---LNA 266

  Fly   277 VDQDEGICAPIQYTI--VQSQDAKYFRIHPHNGAISLLTPIGYAD-----------------VAN 322
            .|:|||:...:.|::  ::......|.:..:||.:.:...:.|.:                 :|.
Human   267 TDRDEGVNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDKGTPPMAG 331

  Fly   323 GATLVVKATQI-DNPDRYALTTVQL--TRPGSHSDLSTLAFVQKRFVMRIREDTAVGNRILALPT 384
            ..|:.|:.... ||....|:|::.|  ......|.:..|..|..|       |:.|..::....|
Human   332 HCTVWVEILDTNDNSPEVAVTSLSLPVREDAQPSTVIALISVSDR-------DSGVNGQVTCSLT 389

  Fly   385 NKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATDGMTNS---TAELTLE 446
                .|:.:.:.....:.:       .|||...||.|.:..:|..|.|.||.:.|   ||.:::|
Human   390 ----PHVPFKLVSTFKNYY-------SLVLDSALDRENVWAYELVVTARDGGSPSLWATARVSVE 443

  Fly   447 VIDVNDWEPRFRETHYEFMVPKS--------SLQSR-ADSFEGVLI--GKVEAADGDRNDKLELS 500
            |.||||..|.|.:..|...|.::        ::.:| ||:.|..|:  ..||...|||.....:|
Human   444 VADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVS 508

  Fly   501 LRGQHAGLFEIDSTGNIYMRPEQLQSLNESTVHLIAI---ATDTGVPPRSTSVPVSV 554
            :   ||      .:|.:|    .||.|:...:.|:..   |.|.||||.|::|.:.|
Human   509 V---HA------ESGKVY----ALQPLDHEELELLQFQVSARDAGVPPLSSNVTLQV 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 26/98 (27%)
Cadherin_repeat 145..244 CDD:206637 27/105 (26%)
Cadherin_repeat 253..347 CDD:206637 21/115 (18%)
Cadherin_repeat 365..452 CDD:206637 22/89 (25%)
Cadherin_repeat 461..555 CDD:206637 30/108 (28%)
PCDHA11NP_061725.1 Cadherin_2 30..111 CDD:285466 17/82 (21%)
Cadherin_repeat 142..238 CDD:206637 26/101 (26%)
Cadherin_repeat 246..345 CDD:206637 16/101 (16%)
Cadherin_repeat 353..450 CDD:206637 28/114 (25%)
Cadherin_repeat 458..560 CDD:206637 30/108 (28%)
Cadherin_repeat 580..669 CDD:206637
6 X 4 AA repeats of P-X-X-P 733..893
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 753..807
Cadherin_tail 798..941 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 826..949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.