DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and PCDHB7

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_061763.1 Gene:PCDHB7 / 56129 HGNCID:8692 Length:793 Species:Homo sapiens


Alignment Length:585 Identity:149/585 - (25%)
Similarity:246/585 - (42%) Gaps:91/585 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILSLCWFNKATLGAILDSRCYLEGGGSAESFLA--TEDLAVGSIIGKLRINGDANAETGDINLSL 74
            :|.||.|...:.......|.::.......:||.  .:||.:|  :|:||..|.......::.:.|
Human    14 VLFLCVFLGMSWAGAEPLRYFVAEETERGTFLTNLAKDLGLG--VGELRARGTRIVSDQNMQILL 76

  Fly    75 REKNAPVEIHPGTKELALSVELDKEGVRGPSSIYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAP 139
                    :...|.:|.|:.:||:|.:.||..  ..|:..:.....|..:....:.|.|:||:||
Human    77 --------LSSLTGDLLLNEKLDREELCGPRE--PCVLPFQLLLEKPFQIFRAELWVRDINDHAP 131

  Fly   140 QWIGTPYTLTLSEVTVPGTRILQGARAEDADQPGPFSTVEYQVLPGPYSEYVQFLNPLEGT---- 200
            .::....:|.:.|.|.||...|..: |:|:| .|..|...|.:.|..|. ::...:..||.    
Human   132 VFLDREISLKILESTTPGAAFLLES-AQDSD-VGTNSLSNYTISPNAYF-HINVHDSGEGNIYPE 193

  Fly   201 LVLKKALDYEQLQNFTVKLRAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPG 265
            |||.:.||.|::..|::.|.|.|.|:|||....|:|:::.|.:|..|.|.|..|..::|.:...|
Human   194 LVLNQVLDREEIPEFSLTLTALDGGSPPRSGTALVRILVLDVNDNAPDFVRSLYKVQVPENSPVG 258

  Fly   266 ELRMRPEPLKAVDQDEGICAPIQYTIVQSQD--AKYFRIHPHNGAISLLTPIGY----------- 317
            .:.:   .:.|.|.|.|....|.|....:.:  .|.|:|:|.:|::.|...:.|           
Human   259 SMVV---SVSARDLDTGSNGEIAYAFSYATERILKTFQINPTSGSLHLKAQLDYEAIQTYTLTIQ 320

  Fly   318 ----ADVANGATLVVKATQIDNPDRYALTTVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAVGNR 378
                ..::...|:||..|.| |.:|..|....||.|.:.:...|:..|   |.:|.|:....|..
Human   321 AKDGGGLSGKCTVVVDVTDI-NDNRPELLLSSLTSPIAENSPETVVAV---FRIRDRDSGNNGKT 381

  Fly   379 ILALPTNKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATD-GMTNSTAE 442
            :.::..:.|      .|..|....|::      ||..||||.|:.|::...:..|| |......|
Human   382 VCSIQDDVP------FILKPSVENFYT------LVTEKPLDRERNTEYNITITVTDLGTPRLKTE 434

  Fly   443 --LTLEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGDRNDKLELSLRGQH 505
              :|:.|.||||..|.|.:|.|...|       |.::...:.||.|.|.|.|.....::      
Human   435 HNITVLVSDVNDNAPAFTQTSYTLFV-------RENNSPALPIGSVSATDRDSGTNAQV------ 486

  Fly   506 AGLFEIDSTGNIYMRPEQLQSLNESTVHLIAI----------------ATDTGVPPRSTSVPVSV 554
              ::.:..:.:.::....|.|:|....||.|:                |||.|.|..|:...|.|
Human   487 --IYSLLPSQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSSEALVRV 549

  Fly   555  554
            Human   550  549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 21/90 (23%)
Cadherin_repeat 145..244 CDD:206637 33/102 (32%)
Cadherin_repeat 253..347 CDD:206637 24/110 (22%)
Cadherin_repeat 365..452 CDD:206637 24/89 (27%)
Cadherin_repeat 461..555 CDD:206637 23/110 (21%)
PCDHB7NP_061763.1 Cadherin_2 30..112 CDD:285466 20/93 (22%)
Cadherin_repeat 137..238 CDD:206637 33/103 (32%)
Cadherin_repeat 247..343 CDD:206637 22/99 (22%)
Cadherin_repeat 356..447 CDD:206637 27/105 (26%)
Cadherin_repeat 455..557 CDD:206637 23/110 (21%)
Cadherin_repeat 576..664 CDD:206637
Cadherin_C_2 683..766 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.