DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and PCDHGA6

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_061742.1 Gene:PCDHGA6 / 56109 HGNCID:8704 Length:932 Species:Homo sapiens


Alignment Length:582 Identity:142/582 - (24%)
Similarity:233/582 - (40%) Gaps:114/582 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEGGGSAE-SFLATEDLAVGSIIGK----LRINGDANAETGDINLSLREKNAPVEIHPGTKELAL 92
            |.|..:|: .:...|:|..||.:|.    |.:.....||.| :.:..|.:.....::|....|..
Human    23 LWGAAAAQIRYSIPEELEKGSFVGNIVKDLGLEPQELAEHG-VRIVSRGRMQLFSLNPRNGSLVT 86

  Fly    93 SVELDKEGVRGPSS---IYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAPQWIGTPYTLTLSEVT 154
            :..:|:|.:...|.   :..|::.     .|...:.||.|.:.|:|||.|:::.....:.:.|..
Human    87 AGRIDREELCAQSPRCLVSFNILV-----EDKLNLYPVEVEIVDINDNTPRFLKEELEVKILENA 146

  Fly   155 VPGTRI--------------LQGARAEDADQPGPFSTVEYQVLPGP-YSEYVQFLNPLEGTLVLK 204
            .|.:|.              |||.:......   ||........|| |.|.|     ||||    
Human   147 APSSRFPLMEVYDPDVGMNSLQGFKLSGNSH---FSVDVQSEAHGPKYPELV-----LEGT---- 199

  Fly   205 KALDYEQLQNFTVKLRAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPGELRM 269
              ||.|....:.:.|.|.|.|.|.|.|...:.|.:.|.:|..|.|.:..|...:|.:...|    
Human   200 --LDREGEAVYRLVLTAMDGGDPVRSSVAQILVTVLDVNDNTPMFTQPVYRVSVPENLPVG---- 258

  Fly   270 RPEPLKAV---DQDEGICAPIQYTIVQSQD--AKYFRIHPHNGAISLLTPIGYAD---------- 319
              .|:.||   |||||:...:.|:.|:..:  ::.|.::...|.||....:.|.|          
Human   259 --TPVLAVTATDQDEGVHGEVTYSFVKITEKISQIFCLNVLTGEISTSANLDYEDSSFYELGVEA 321

  Fly   320 -----VANGATLVVKATQI-DNPDRYALTTVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAVGNR 378
                 :.:.|.:::....: ||.....:|:...|...|....:.:|.    |.:..|:....|..
Human   322 RDGPGLRDRAKVLITILDVNDNVPEVVVTSGSRTIAESAPPGTVIAL----FQVFDRDSGLNGLV 382

  Fly   379 ILALPTNKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATDGMT---NST 440
            ..::|.:.|.:..|            |||:...||....||.|::..:...|.|||..|   ::.
Human   383 TCSIPRSLPFELEK------------SVGNYYRLVTNAALDREEVFLYNITVTATDKGTPPLSTE 435

  Fly   441 AELTLEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGDRNDKLELS----- 500
            ..::|.|.|.||..|.|..:.|...|.:::.:       |..|..|.|.|.|.:...::|     
Human   436 TIISLNVADTNDNPPTFPHSSYSVYVLENNPR-------GASIFSVNALDPDVDQNAQVSYSLAE 493

  Fly   501 --LRGQHAGLF-EIDS-TGNIY-MRP---EQLQSLNESTVHLIAIATDTGVPPRSTSVPVSV 554
              |:|.....: .|:| ||.:| :|.   |||:.|     .|...|:|:|.||.|::|.:|:
Human   494 DTLQGAPLSSYVSINSDTGILYALRSFDYEQLRDL-----QLWVTASDSGDPPLSSNVSLSL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 22/97 (23%)
Cadherin_repeat 145..244 CDD:206637 29/113 (26%)
Cadherin_repeat 253..347 CDD:206637 23/114 (20%)
Cadherin_repeat 365..452 CDD:206637 22/89 (25%)
Cadherin_repeat 461..555 CDD:206637 30/107 (28%)
PCDHGA6NP_061742.1 Cadherin_2 30..112 CDD:285466 16/87 (18%)
Cadherin_repeat 137..238 CDD:206637 29/114 (25%)
Cadherin_repeat 246..343 CDD:206637 20/102 (20%)
Cadherin_repeat 355..448 CDD:206637 26/108 (24%)
Cadherin_repeat 456..558 CDD:206637 30/107 (28%)
Cadherin_repeat 579..666 CDD:206637
Cadherin_C_2 688..772 CDD:293101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..841
Cadherin_tail 809..>905 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 902..932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.