DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and PCDHGC4

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_061751.1 Gene:PCDHGC4 / 56098 HGNCID:8717 Length:938 Species:Homo sapiens


Alignment Length:586 Identity:138/586 - (23%)
Similarity:232/586 - (39%) Gaps:149/586 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GGSAESFLA-TEDLAVGSIIGKLRINGDANAETGDINLSLREKNAPVEIHPGTKELALSVELDKE 99
            |..|:.||. |:.|:.    .:|::.|:.|           :::..|::..|.  |.:...:|:|
Human    46 GNVAQDFLLDTDSLSA----RRLQVAGEVN-----------QRHFRVDLDSGA--LLIKNPIDRE 93

  Fly   100 GVRGPSSIYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAPQWIGTPYTLTLSEVTVPGTRI-LQG 163
            .:.|.|:..  ::.:...:..|..:....|.:.||||:||::......|.:.|...||.|. |: 
Human    94 ALCGLSASC--IVPLEFVTEGPLEMYRAEVEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLE- 155

  Fly   164 ARAEDADQPGPFSTVEYQVLPGPYSEYVQFLNPLEGTLV----LKKALDYEQLQNFTVKLRAQDQ 224
             :|:||| .|..|...|::....:.. :......:|:||    |:|.||.|:..::.:.|.|.|.
Human   156 -KAQDAD-VGSNSISSYRLSSNEHFA-LDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDG 217

  Fly   225 GTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPGELRMRPEPLKAVDQDEGICAPIQY 289
            |.|||.....|||.:.|.:|..|.||:.||...:......|.:.::   |.|.|.|.|....:.:
Human   218 GNPPRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQ---LNASDPDLGPSGNVTF 279

  Fly   290 TI---VQSQDAKYFRIHPHNGAISLLTPIGY------------------------------ADVA 321
            ..   ...:....|.:||..|.::||.|:.:                              .||.
Human   280 YFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFDVRARDGGSPAMEQHCSLRVDLLDVN 344

  Fly   322 NGATLVVKATQIDN-PDR------YALTTVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAVGNRI 379
            :.|..:...:::.. |:.      .||.:||....||:.|:|                       
Human   345 DNAPYITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVS----------------------- 386

  Fly   380 LALPTNKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATDG-----MTNS 439
            |.:|     .||.:.:.....:||       .||.|.|||.|..:.::..|.|:|.     .|:.
Human   387 LRIP-----DHLPFALKSAFRNQF-------SLVTAGPLDREAKSSYDIMVTASDAGNPPLSTHR 439

  Fly   440 TAELTLEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGDR--NDKLELSL- 501
            |  :.|.:.||||..|.|.:..:|..||:::.       .|.|:..:.|:|.|.  |..:..|| 
Human   440 T--IFLNISDVNDNPPSFFQRSHEVFVPENNR-------PGDLLCSLAASDPDSGLNALISYSLL 495

  Fly   502 --RGQHAGLFEIDSTGNIYMRP-------------EQLQSLNESTVHLIAIATDTGVPPRSTSVP 551
              |.:     ::.::..|.:.|             ||.|     |:.....|.|.|.||.|::|.
Human   496 EPRNR-----DVSASSFISLNPQTGAVHATRSFDYEQTQ-----TLQFEVQARDRGNPPLSSTVT 550

  Fly   552 V 552
            |
Human   551 V 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 16/90 (18%)
Cadherin_repeat 145..244 CDD:206637 32/103 (31%)
Cadherin_repeat 253..347 CDD:206637 23/133 (17%)
Cadherin_repeat 365..452 CDD:206637 21/91 (23%)
Cadherin_repeat 461..555 CDD:206637 26/110 (24%)
PCDHGC4NP_061751.1 Cadherin_repeat 246..346 CDD:206637 17/102 (17%)
Cadherin_repeat 358..451 CDD:206637 31/129 (24%)
Cadherin_repeat 461..561 CDD:206637 26/108 (24%)
Cadherin_repeat 580..666 CDD:206637
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..847
Cadherin_tail 817..>911 CDD:374265
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 908..938
Cadherin_2 30..111 CDD:369785 16/83 (19%)
Cadherin_repeat 140..238 CDD:206637 32/101 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.