DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and pcdh1gb9

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001018614.3 Gene:pcdh1gb9 / 553940 ZFINID:ZDB-GENE-041118-18 Length:937 Species:Danio rerio


Alignment Length:583 Identity:136/583 - (23%)
Similarity:251/583 - (43%) Gaps:98/583 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ILDSRCYLEGGGSAESFLATEDLAVGSIIGKLRINGDANAE---TGDINLSLREKNAPVEIHPGT 87
            ||....|:..|  ..|:...|::|.||::|.:..:...:.:   :|...:..|:....:|::..|
Zfish    15 ILTLLVYIARG--QVSYSIPEEMAKGSMVGNIAQDLGLDLQRLKSGKARIFSRDSTEYIELNRNT 77

  Fly    88 KELALSVELDKEGV---RGPSSIYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAPQWIGTPYTLT 149
            ..|.:..::|:|.:   ..|.::::.:|.     .:|..:..:.|.:||:|||||.:....:...
Zfish    78 GLLLIKEKMDRESLCAKTTPCALHLQMIL-----DNPMELYTITVEITDINDNAPNFQKRDFKFE 137

  Fly   150 LSEVTVPGTRILQGARAEDADQPGPFSTVEYQVLPGPYSEYVQFLNPLEGT----LVLKKALDYE 210
            :||..:.|.|.:.| :|.|.| .|..|...|.:.|..... ::..:..:|:    ::|:||||.|
Zfish   138 ISESAMVGARFMLG-KAFDPD-VGTNSLQSYSLKPTDKFR-LELQSQADGSKNVEMILQKALDRE 199

  Fly   211 QLQNFTVKLRAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPGELRMRPEPLK 275
            ...:||:.|.|.|.|.|.......:.:.:.|.:|..|.|.::.|.|....:...|.:.   ..:.
Zfish   200 MQSSFTLLLEAFDGGDPVLSGTVQIHIAVLDINDNAPVFMQKEYKATATEEAPKGSIL---TVVS 261

  Fly   276 AVDQDEGICAPIQYTIVQSQD---AKYFRIHPHNGAISLLTPIGYADV---------------AN 322
            |.|.|||..:.:.|.|..:.|   |..|.::...|.:.|.....|..|               :|
Zfish   262 ATDTDEGSNSEVTYYISDTMDSVMADMFLVNEQTGELILNGHFDYEKVSHYELTIHAKDQGGLSN 326

  Fly   323 GATLVVKATQI-DN-PDRYALTTVQLTRPGSH----------SDLSTLAFVQKRFVMRIREDTAV 375
            ...:::....: || |....|::......||.          .||.:.|..|.:.||        
Zfish   327 ACKVIIDVLDVNDNSPSINILSSSHSVSEGSKFGTVIAMLNVDDLDSGASGQVQCVM-------- 383

  Fly   376 GNRILALPTNKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATD-GM--T 437
                        .:.:.:||... :|.|||      |...:.||.|:.|::...|:.:| |:  .
Zfish   384 ------------SEEIPFVIKSQ-SSNFFS------LQTEQELDRERETEYNISVICSDEGVPSL 429

  Fly   438 NSTAELTLEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGDRNDKLELSLR 502
            :|:..||:::.||||..|.|::::||..|.:::.       .|:.|..|:|:|.|.|....:|..
Zfish   430 SSSVSLTVQISDVNDNPPVFKKSNYEAFVMENNT-------PGLSIFTVKASDADWNQNARVSYI 487

  Fly   503 GQHAGLFEIDSTGNIYMRPEQ-----LQSLNESTV---HLIAIATDTGVPPRSTSVPVSVTME 557
            .:.:.:..:..:..:.:.|:.     ::|.:..|:   |....|.|.|.||.|::|.|.||::
Zfish   488 LEDSTVSGVSVSSYVSVHPDSGLITAVRSFDYETLKDFHFRVKAQDGGSPPLSSNVTVKVTVQ 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 19/96 (20%)
Cadherin_repeat 145..244 CDD:206637 27/102 (26%)
Cadherin_repeat 253..347 CDD:206637 22/113 (19%)
Cadherin_repeat 365..452 CDD:206637 21/89 (24%)
Cadherin_repeat 461..555 CDD:206637 23/101 (23%)
pcdh1gb9NP_001018614.3 Cadherin_2 26..108 CDD:311943 15/86 (17%)
Cadherin_repeat 134..234 CDD:206637 27/102 (26%)
Cadherin_repeat 242..340 CDD:206637 18/100 (18%)
CA 367..447 CDD:214520 27/106 (25%)
Cadherin_repeat 454..555 CDD:206637 25/104 (24%)
Cadherin_repeat 574..662 CDD:206637
Cadherin_C_2 683..765 CDD:318652
Cadherin_tail 804..923 CDD:318236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.