DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and Cad87A

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster


Alignment Length:692 Identity:150/692 - (21%)
Similarity:286/692 - (41%) Gaps:181/692 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RING--------DANAETGDINLSLREKNAPVEI-HPGTKELALSVELDKEGVRGPSSIYVNVIC 113
            ||.|        |.:.|||.|   :...||.::: :..:.:|..:||                  
  Fly   705 RIRGSEQVESIFDIDRETGQI---IIRPNATLDVTNLNSDQLIFAVE------------------ 748

  Fly   114 IRRHSTDPSFV--IPVNVRVTDVNDNAPQWIGTPYTLTLSEVTVPGTRILQGARAEDADQPGPFS 176
                :.|..|.  ..||:.|.|||::.|.:....|:..:.|.:..||.: :...|.|.| .|..:
  Fly   749 ----ANDGLFTAHCGVNITVRDVNNHVP
NFEQQSYSAVVEENSEIGTSV-ERVHATDLD-TGKNA 807

  Fly   177 TVEYQVLPGPYSEYVQFLNPLEGTLVLKKALDYEQLQNFTVKLRAQDQGTPPRHSDTLLRVVITD 241
            .:.|::..|.:.::  .:....|.:.:.:.||:::...:.::::|.|||||.......|.:.:.:
  Fly   808 ELRYRIQQGSFDDF--GIVETTGEVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQN 870

  Fly   242 ADDQNPKFQRESYSAEIPADGRPGEL-----RMRP-------------EPLKAVDQDEGICAPIQ 288
            ::|::|.|...:..||:.||..||:|     .:.|             :.:.|:|: ||...| .
  Fly   871 SND
KDPYFVPATQHAEVRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDK-EGKELP-H 933

  Fly   289 YTIVQSQDAKYFRIHPHNGAIS-----------------LLTPIGYADVANG-ATLVVKATQID- 334
            |    .|..:||:| ..||.:|                 |:|.....:|..| ..|:::...:: 
  Fly   934 Y----DQFKEYFKI-SRNGKVSVNKQLDRNLFAVMRINVLVTDSTAPNVQQGRGLLIIQIIDVNK 993

  Fly   335 NPDRYALTTVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAVGNRILALPTNKPGKHL-KYVIPDP 398
            ||.|:       ..|.|        ..|.:..:::.|:..||..:..|..|.....: ::.|.| 
  Fly   994 N
PPRF-------NAPWS--------VEQPQIKLQMVEEQPVGTVLTTLQANDEDSSIGEFNISD- 1042

  Fly   399 VNSQFFSVGSLGELV--LAKPLDYEKMTKHEFQVLATD-GM--TNSTAELTLEVIDVNDWEPRFR 458
              :.:|::.....::  :|: ||||.:.:.:|||..:| |:  ..:||::.:::|::||.:|:|.
  Fly  1043 --NDYFAINQTSGMIYTIAR-LDYEVVKEVKFQVTVSDTGVPALTATADVVVDIINLNDNDPKFS 1104

  Fly   459 ETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGDRN--DKLELSLRGQHAGLFEIDS-TGNIYMR 520
            ::.|.|.|.::|.:       |.:.|||||.|||..  .::..:|.|::...|.||: |||:.:.
  Fly  1105 QSDYYFNVTENSPR-------GTVAGKVEAHDGDVGVFGEITYTLIGENNKYFSIDAYTGNVMVA 1162

  Fly   521 PEQL---QSLNESTVHLIAIATDTGVPPRSTSVPVSVTM-----EGLTLARSGWNSNML------ 571
            ...:   :.:.|.|:.::|.........:|.:..:.:.:     ......|..:||.:.      
  Fly  1163 NSSILDREQIKELTLSVVAQDKAPAAVQKSATATIHINILDVNDNAPVFTRDVYNSTVAENAAYQ 1227

  Fly   572 ---------------GMFGMI---------MGLFLMIIVALSCYIVRSKKQGKSASSGLGLGRNR 612
                           |::|.:         ||||.:                 .|.||:      
  Fly  1228 PPAALLQVQAIDQDEGLYGDVRYIITAGNEMGLFKL-----------------DAQSGI------ 1269

  Fly   613 VH-SQAHSSVSSANLVTHEKLAGNGNGNGASVTSGGVSVLHM 653
            |: :|:.|....|..:|.......|:|...|.|...::||.:
  Fly  1270 VYPAQSLSGKHGAYELTISARDTQGSGTMESTTKAIITVLRV 1311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 21/89 (24%)
Cadherin_repeat 145..244 CDD:206637 20/98 (20%)
Cadherin_repeat 253..347 CDD:206637 29/130 (22%)
Cadherin_repeat 365..452 CDD:206637 21/92 (23%)
Cadherin_repeat 461..555 CDD:206637 25/99 (25%)
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831
CA 692..772 CDD:214520 21/91 (23%)
Cadherin_repeat 778..873 CDD:206637 20/98 (20%)
Cadherin_repeat 882..994 CDD:206637 26/118 (22%)
Cadherin_repeat 1015..1099 CDD:206637 22/87 (25%)
Cadherin_repeat 1108..1207 CDD:206637 25/105 (24%)
Cadherin_repeat 1215..1314 CDD:206637 22/120 (18%)
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24028
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.