DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and Pcdhac1

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001003671.1 Gene:Pcdhac1 / 353236 MGIID:1891442 Length:964 Species:Mus musculus


Alignment Length:608 Identity:149/608 - (24%)
Similarity:246/608 - (40%) Gaps:140/608 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LCWFNKATLGAILDSRCYLEGGGSAESFLATE---DLAVGSIIGKLRINGDANAETGDINLSL-- 74
            |||:  .:.||         ..|..|..:..|   .:.||:|...|:::...        |||  
Mouse     9 LCWW--VSCGA---------AAGQLEYSVLEETEPGVTVGNIASDLKLSAAV--------LSLRN 54

  Fly    75 -------REKNAPVEIHPGT---KELALSVELDKEGVRGPSSIYVNVICIRRHS---TDPSFVIP 126
                   ||....|::..|:   :|||     |:|.:     ......||..:.   .||..:..
Mouse    55 FRFLSNYRESYFGVDLGSGSLVVQELA-----DREQL-----CPAKASCILTYELMFEDPLELHK 109

  Fly   127 VNVRVTDVNDNAPQWIGTPYTLTLSEVTVPGTRILQGARAEDADQPGPFSTVEYQVLPGPY---- 187
            :.|.:.|.|||:|.:......|.:.|...||.|.:. ..|:|||: |....:.|.:....:    
Mouse   110 IRVHLLDTNDNSPLFPAGDVHLHIPEFLPPGARFIL-PNAQDADE-GSNGALSYSLSISQHFRLD 172

  Fly   188 -------SEYVQFLNPLEGTLVLKKALDYEQLQNFTVKLRAQDQGTPPRHSDTLLRVVITDADDQ 245
                   |:|.:        |||:||||.||.....:.|.|||.|.|.|.....:.:.:.|.:|.
Mouse   173 MGSRVDGSKYPE--------LVLEKALDREQRDTHLLVLTAQDGGLPARSGAAQVTITVVDTNDN 229

  Fly   246 NPKFQRESYSAEIPADGRPGELRMRPEPLKAVDQDEGICAPIQYTIVQSQDAK---YFRIHPHNG 307
            .|.|:...||.::|.....|.:...   ::|:|.|||....:.|::..|..|:   .|.:||.:|
Mouse   230 APVFEHSVYSTKVPETAPNGTVLFH---VQALDPDEGSNGEVWYSLSNSTPAELRHLFHVHPKSG 291

  Fly   308 AISLLTPIGYADVANGATLVVKATQIDNPDRYALTT-----VQLTRPGSHS---DLSTLAFVQKR 364
            .:.:...:|..:     ||:....:..:...::|.:     |::|....|:   |..|       
Mouse   292 EVQVAASLGPPE-----TLLEAFVEARDEGAFSLASTTKLLVEVTDVNDHAPQMDFMT------- 344

  Fly   365 FVMRIREDTAVGNRILALPTNKP---GKHLKYVIPDPVNSQF---FSVGSLGELVLAKPLDYEKM 423
            |...|.||.|.|. ::||.:.|.   |.:.|..........|   .|..|...|:...|||.|:.
Mouse   345 FSSSILEDAAPGT-VIALLSVKDEDLGSNGKVTCSMSSKGPFQLKASFDSYYRLLTDGPLDREQA 408

  Fly   424 TKHEFQVLATDGMT---NSTAELTLEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGK 485
            ::::..:.|:||.:   ::...||:.|.||||..|.|.:...|..|.:       ::..||.:|.
Mouse   409 SEYQILISASDGGSPPLSTRRTLTVSVADVNDNTPNFPQPQQELFVAE-------NNSPGVSLGG 466

  Fly   486 VEAADGDR--------------NDKLELSLRGQHAGLFEID-STGNIYMRP----EQLQSLNEST 531
            |.|.|.|.              ::::.:|     :.|..:: :||.|..:.    |||:..|...
Mouse   467 VFAQDPDLGENGFVFYELLDVISERMPVS-----SSLVAVEPTTGVITAKTSFDFEQLRGFNFQV 526

  Fly   532 VHLIAIATDTGVPPRSTSVPVSV 554
            .     ..|.|:||||.:|.|::
Mouse   527 E-----GRDGGIPPRSATVTVNL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 24/108 (22%)
Cadherin_repeat 145..244 CDD:206637 30/109 (28%)
Cadherin_repeat 253..347 CDD:206637 21/101 (21%)
Cadherin_repeat 365..452 CDD:206637 27/95 (28%)
Cadherin_repeat 461..555 CDD:206637 26/113 (23%)
Pcdhac1NP_001003671.1 E_set 21..103 CDD:298831 20/99 (20%)
Cadherin_repeat 130..229 CDD:206637 30/108 (28%)
Cadherin_repeat 237..336 CDD:206637 22/106 (21%)
Cadherin_repeat 344..441 CDD:206637 29/104 (28%)
Cadherin_repeat 451..552 CDD:206637 26/111 (23%)
Cadherin_repeat 570..653 CDD:206637
Cadherin_tail 813..956 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.