DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and PCDHB1

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_037472.2 Gene:PCDHB1 / 29930 HGNCID:8680 Length:818 Species:Homo sapiens


Alignment Length:584 Identity:152/584 - (26%)
Similarity:245/584 - (41%) Gaps:95/584 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LGAILDSRCYLEGGGSAESFLATEDLAVGSI-----------IGKLRINGDANAETGDINLSLRE 76
            :|::|...|...|..:...:...|::..||.           :|||...|......|: .:..| 
Human    14 VGSLLIFLCISVGDATTIRYSVAEEMESGSFVANVAKDLGLEVGKLAARGARLVSEGN-KMHFR- 76

  Fly    77 KNAPVEIHPGTKELALSVELDKEGVRG---PSSIYVNVICIRRHSTDPSFVIPVNVRVTDVNDNA 138
                  :|..|.:|.:..:||:|.:.|   |..::..|:.:     :|.......|||.|:||||
Human    77 ------LHRKTGDLFVKEKLDRESLCGKADPCVLHFEVVLV-----EPLQSFRAEVRVFDINDNA 130

  Fly   139 PQWIGTPYTLTLSEVTVPGTRI-LQGARAEDADQPGPFSTVEYQVLP--GPYSEYVQFLN--PLE 198
            |.::.....|.:.|.|..|:|. ||.|:..|....|    ::...|.  |.:..:.:|.:  |..
Human   131 PVFLNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNG----LQNYTLSANGYFHLHTRFCSHGPKY 191

  Fly   199 GTLVLKKALDYEQLQNFTVKLRAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGR 263
            ..|||.|.||.|:.....:.:.|.|.|:||:.....:.||:.|.:|..|:|.|..|.|::..:..
Human   192 AELVLNKPLDREEQPEVNLTITAVDGGSPPKSGTAHIHVVVLDVNDHVPQFSRLVYRAQVSENSP 256

  Fly   264 PGELRMRPEPLKAVDQDEGICAPIQYTIVQSQDA--KYFRIHPHNGAISLLTPIGYADV------ 320
            .|.|   ...:.|||.|||....|.|::.|:.:|  |.|:|.|.||.:.|..|:.:..:      
Human   257 NGSL---VATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDID 318

  Fly   321 ----------ANGATLVVKATQIDNPDRYALTTVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAV 375
                      |:...||......|||....:::|....|......:.:|.    |.:|.| |..|
Human   319 IQATDGGGLSAHSKVLVEVVDVNDNPPEVMVSSVSSPLPEDSPPQTVVAL----FTIRDR-DIRV 378

  Fly   376 GNRILALPTNKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATD-GMTNS 439
            |.::...        |:..:|..:...|   |:...||..:.||.|:::.:...::|.| |..:.
Human   379 GGKVTCF--------LREDLPFVIKPTF---GNSYSLVTDRSLDREEVSGYNITIVAMDTGPPSL 432

  Fly   440 TAELTLEVI--DVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGD--RNDKLELS 500
            :||..:||:  ||||..|.|||..|...|       |.::...|.||||.|.|.|  .|.::..|
Human   433 SAETMIEVLISDVNDNPPIFREDSYILTV-------RENNSPAVFIGKVHAEDLDLGENAQITYS 490

  Fly   501 LRGQHAGLFEI-------DSTGNIY-MRPEQLQSLNESTVHLIAIATDTGVPPRSTSVPVSVTM 556
            |.....|...:       ...|.:| :|....:::.:  ...:..|||.|....|:.|.|.|.:
Human   491 LLPPKNGDLSVFAYISINSGNGKLYALRTMDYEAIQD--FQFVVKATDGGFLSLSSQVTVRVVV 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 24/104 (23%)
Cadherin_repeat 145..244 CDD:206637 29/103 (28%)
Cadherin_repeat 253..347 CDD:206637 29/111 (26%)
Cadherin_repeat 365..452 CDD:206637 24/89 (27%)
Cadherin_repeat 461..555 CDD:206637 25/103 (24%)
PCDHB1NP_037472.2 Cadherin_2 30..110 CDD:311943 18/87 (21%)
Cadherin_repeat 140..238 CDD:206637 29/101 (29%)
Cadherin_repeat 246..343 CDD:206637 25/99 (25%)
Cadherin_repeat 356..448 CDD:206637 27/107 (25%)
Cadherin_repeat 456..558 CDD:206637 26/106 (25%)
Cadherin_repeat 577..665 CDD:206637
Cadherin_C_2 688..772 CDD:318652
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 789..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4632
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.