DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Cb and Pcdh9

DIOPT Version :9

Sequence 1:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001074846.1 Gene:Pcdh9 / 211712 MGIID:1306801 Length:1237 Species:Mus musculus


Alignment Length:574 Identity:139/574 - (24%)
Similarity:240/574 - (41%) Gaps:110/574 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EDLAVGSIIGKLRINGDANAETGD-----INLSLREKNAP-VEIHPGTKEL-ALSVELDKEGVRG 103
            |::.:|:|...|.|: ..||.||.     ..|..:..:|| |::...|.|: ..|..:|:|.:..
Mouse    36 ENVPIGNIPKDLNIS-HINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCA 99

  Fly   104 PSS--------IYVNVICIRRHSTDPSFVIPVNVRVTDVNDNAPQWIGTPYTLTLSEVTVPGTRI 160
            .:|        ..:.|:.:   ..|...:|.:.:.|.|.|||||.:......:::.|.|:..:|.
Mouse   100 GASYAEENECFFELEVVIL---PNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRF 161

  Fly   161 -LQGARAEDADQPGPFSTVE-YQVLPGPYSEYVQFLNPLEG----TLVLKKALDYEQLQNFTVKL 219
             :..|...|..    |:.|: |::|.|.....:..:...||    .|::::.||.||...:.:|:
Mouse   162 PIPSATDPDTG----FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKI 222

  Fly   220 RAQDQGTPPRHSDTLLRVVITDADDQNPKFQRESYSAEIPADGRPGELRMRPEPLKAVDQDEGIC 284
            :.:|.|||.:.|..:|:|.::|.:|..|.|:.......||.:...|...::   |.|.|.|.|..
Mouse   223 KVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQ---LHATDADIGSN 284

  Fly   285 APIQY-----------------------TIVQSQDAKYFRIHPHNGAISLLTPIGYADVANGATL 326
            |.|:|                       |:.:|.|.:...||    .:::|...|.:..|. ||:
Mouse   285 AEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPAR-ATV 344

  Fly   327 VVKATQI-DNPD----RYALT----TVQLTRPGSHSDLSTLAFVQKRFVMRIREDTAVGNRILAL 382
            .:..|.: |||.    ||.::    ||.|:.....:....|..|..:       ||.|..:::..
Mouse   345 TINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDK-------DTDVNGKVICF 402

  Fly   383 PTNKPGKHLKYVIPDPVNSQFFSVGSLGELVLAKPLDYEKMTKHEFQVLATDG---MTNSTAELT 444
            ...:...|||.|..   |.......||        ||||...:..|:::|:|.   ..|.||.:.
Mouse   403 IEREVPFHLKAVYD---NQYLLETSSL--------LDYEGTKEFSFKIVASDSGKPSLNQTALVR 456

  Fly   445 LEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKVEAADGDRNDKLELSLR-GQHAGL 508
            :::.|.||..|.|.:...|..|.:::.:       |:.:..:.|.|.|.....::..: |.:|..
Mouse   457 VKLEDENDNPPIFNQPVIELSVSENNRR-------GLYLTTISATDEDSGKNADIVYQLGPNASF 514

  Fly   509 FEID-STG-----NIYMRPEQLQSLNESTVHLIAIATDTGVPPRSTSVPVSVTM 556
            |::| .||     .::.|.||.:.:...|      |.|.|.||..:...|.||:
Mouse   515 FDLDRKTGVLTASRVFNREEQERFIFTVT------ARDNGTPPLQSQAAVIVTV 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 25/105 (24%)
Cadherin_repeat 145..244 CDD:206637 26/104 (25%)
Cadherin_repeat 253..347 CDD:206637 29/125 (23%)
Cadherin_repeat 365..452 CDD:206637 21/89 (24%)
Cadherin_repeat 461..555 CDD:206637 22/100 (22%)
Pcdh9NP_001074846.1 E_set 28..117 CDD:298831 20/81 (25%)
Cadherin_repeat 146..248 CDD:206637 26/105 (25%)
Cadherin_repeat 258..354 CDD:206637 22/103 (21%)
Cadherin_repeat 370..465 CDD:206637 27/112 (24%)
Cadherin_repeat 473..568 CDD:206637 24/103 (23%)
Cadherin_repeat 576..671 CDD:206637
Cadherin_repeat 687..776 CDD:206637
Protocadherin 777..997 CDD:285562
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.