DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and SLC22A13

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_004247.2 Gene:SLC22A13 / 9390 HGNCID:8494 Length:551 Species:Homo sapiens


Alignment Length:431 Identity:92/431 - (21%)
Similarity:160/431 - (37%) Gaps:116/431 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLM-----FVTSVWL 122
            :|||:   |.||    |:.:.|.::|.:.|.|||:..:|     :..|.|.|:     ||.|..|
Human   138 DTTQS---VFMA----GLLVGTLMFGPLCDRIGRKATIL-----AQLLLFTLIGLATAFVPSFEL 190

  Fly   123 FNIINLLVGISVGAVSAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAIT 187
            :..:...|..:|..:|.:....|:|:..|..|..|:..:....|:..:.:...|           
Human   191 YMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLA----------- 244

  Fly   188 MGDFVFRPWRLLLLVSLLPGFIGGLILLYY----PESPKFLLSQEKNNEAIEAVAWISKFNRGKS 248
               :.||.||||.:....|    ||:|.:|    |||.::||::.:.:|||:.:...:..||.|.
Human   245 ---YGFRNWRLLQITGTAP----GLLLFFYFWALPESARWLLTRGRMDEAIQLIQKAASVNRRKL 302

  Fly   249 IQQVLSCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFN---FILCNLALFGMF 310
            ..:::  ::...:...|.|.                  .:.||..|....   .|.|        
Human   303 SPELM--NQLVPEKTGPSGN------------------ALDLFRHPQLRKVTLIIFC-------- 339

  Fly   311 FSSNGMQLWFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAF 375
                   :||.:    |.|....|..|.:.            .||        .|:..|:.|...
Human   340 -------VWFVD----SLGYYGLSLQVGDF------------GLD--------VYLTQLIFGAVE 373

  Fly   376 LIGFSIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYI----LLPGLSISIM 436
            :........::...|||...|..|.:..|..:::.|:.:...|:|.....:    .....:||.:
Human   374 VPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTMLAVVGKMATAAAFTISYV 438

  Fly   437 IGAIVDLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQP 477
            ..|  :|.||.||...         :|::...:.:|.:|.|
Human   439 YSA--ELFPTILRQTG---------MGLVGIFSRIGGILTP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 90/427 (21%)
MFS 34..>189 CDD:119392 31/130 (24%)
SLC22A13NP_004247.2 2A0119 12..510 CDD:273328 92/431 (21%)
MFS 139..500 CDD:119392 92/430 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..551
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.