DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and SLC22A6

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_004781.2 Gene:SLC22A6 / 9356 HGNCID:10970 Length:563 Species:Homo sapiens


Alignment Length:450 Identity:85/450 - (18%)
Similarity:170/450 - (37%) Gaps:111/450 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQ-FVLMFVTSVWLFNIINLLVGISVGAVSAA 140
            :.|:.|...::||::|.:|||:||:. |:...|:. ....|..:..::....||.|:::..:|  
Human   142 MVGVLLGAMVFGYLADRLGRRKVLIL-NYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGIS-- 203

  Fly   141 LYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFR-------PWRL 198
                             :|..|:.|....|:..|....::  .:..::|.|:..       .||.
Human   204 -----------------LNCMTLNVEWMPIHTRACVGTLI--GYVYSLGQFLLAGVAYAVPHWRH 249

  Fly   199 LLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCD--EFTLK 261
            |.|:...|.|...:...::.||.::..|..:.:..:.|:..:::.|..:.....||.:  ..:|:
Human   250 LQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREEGAKLSMEVLRASLQ 314

  Fly   262 SEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILC--------NLALFGMFFSSNGMQL 318
            .|..:|:   |::....:|.  |.....||         ||        :.|.:|:.....|..:
Human   315 KELTMGK---GQASAMELLR--CPTLRHLF---------LCLSMLWFATSFAYYGLVMDLQGFGV 365

  Fly   319 WFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQG 383
                           |..:.:::...|:.|                         |.|:||    
Human   366 ---------------SIYLIQVIFGAVDLP-------------------------AKLVGF---- 386

  Fly   384 LILNPLGRKNVLLAALAVA----TLSGVL---LHFMESPTGVLVLFCLYILLPGLSISIMIGAIV 441
            |::|.|||:...:|||.:|    .|:||:   ...:.:...||...||     ..|.:.:.....
Human   387 LVINSLGRRPAQMAALLLAGICILLNGVIPQDQSIVRTSLAVLGKGCL-----AASFNCIFLYTG 446

  Fly   442 DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501
            :|.||.:|...:....::.|:|.|.:. |:.:..:.|.:....::....:....:...||
Human   447 ELYPTMIRQTGMGMGSTMARVGSIVSP-LVSMTAELYPSMPLFIYGAVPVAASAVTVLLP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 82/422 (19%)
MFS 34..>189 CDD:119392 22/112 (20%)
SLC22A6NP_004781.2 2A0119 11..515 CDD:273328 84/449 (19%)
MFS 135..505 CDD:119392 83/448 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.