DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and OCT6

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_173087.1 Gene:OCT6 / 838207 AraportID:AT1G16370 Length:521 Species:Arabidopsis thaliana


Alignment Length:459 Identity:98/459 - (21%)
Similarity:177/459 - (38%) Gaps:127/459 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NVWDYDMVLEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCEFETTQAEKGVMMAASV 77
            :.|::|        |.:|       |...|:....:.:.|::              :|:..:|..
plant    96 SAWEWD--------GGSQ-------GKSVISEFGLECSSSLL--------------RGMPSSAFY 131

  Fly    78 TGIFLSTYIWGYISDD-IGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAAL 141
            .|..:..:....|.|| :||::::|:..||.:.....::|.|:||::..:..::|.|.....:..
plant   132 IGAIVGGFFLALIPDDSLGRKKLVLFSTFAMSITSISVIFSTNVWIYTFLKFIIGFSRSQTWSYA 196

  Fly   142 YAYLSEFNIP---RHRAVAINYSTM---FVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLL 200
            ...:|| .:.   |.||..|.::..   |:|::.|     |:|...|:            ||.|.
plant   197 LVLISE-RVSTRWRPRATMIPFTLFVLGFMSLSGI-----AFLAQDSS------------WRYLY 243

  Fly   201 LVSLLPG-FIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSED 264
            |.:.:|. |....:.|:..|||::|..|.|:.|||:.:..:|...:. .::.|:|  :..||.|:
plant   244 LYTSVPAVFYCIFLYLFALESPRWLHMQGKDKEAIDVLTKMSPKEKA-YLESVVS--KLPLKQEN 305

  Fly   265 PVGENLLGESQGCGILSKICRATIPLFHKPHGFNFIL-CNLALFGMFFSSNGMQLWFPEI-VNRS 327
                  ..::....|..        .|.:...|..|| ..:.:||:..|..|:.|...:| ||  
plant   306 ------FEQAPTYSIKD--------FFFRKWAFRRILVVMIIMFGLGISYYGVPLAARDIDVN-- 354

  Fly   328 SGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRK 392
                   ..:.|.|:..||.|.                             |.|..::|....|:
plant   355 -------IYLSETLNALVELPT-----------------------------FVITPILLERFNRR 383

  Fly   393 NVLLAALAVATLSGVLLHFMESPTG---------VLVLFCLYILLPGLSISIMIGAIVDLVPTHL 448
            :.:|....:...||||. |:.|..|         :...||..|     ..::|...:|::.||.:
plant   384 SSVLVNTLLGGASGVLC-FVLSILGKTEIAFAFELGTFFCARI-----GFNLMAVFMVEMFPTCV 442

  Fly   449 RSKA 452
            ||.|
plant   443 RSSA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 95/443 (21%)
MFS 34..>189 CDD:119392 32/161 (20%)
OCT6NP_173087.1 MFS_OCT_plant 88..494 CDD:340936 98/459 (21%)
xylE <220..>314 CDD:182225 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.