DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and SLC22A2

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens


Alignment Length:497 Identity:123/497 - (24%)
Similarity:192/497 - (38%) Gaps:128/497 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSLESN----TLGP--NVWDYDMVLEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCE 61
            :||::|    .|||  :.|.|:                 ..|...:|...       :|.|:...
Human   108 ASLDTNRSRLPLGPCRDGWVYE-----------------TPGSSIVTEFN-------LVCANSWM 148

  Fly    62 FETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFV--TSVWLFN 124
            .:..|:...|       |.|:.:...|||:|..||:..|| .....||...|||.:  |..|:. 
Human   149 LDLFQSSVNV-------GFFIGSMSIGYIADRFGRKLCLL-TTVLINAAAGVLMAISPTYTWML- 204

  Fly   125 IINLLVGISVGAVSAALYAYLSEFNIPRH-RAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITM 188
            |..|:.|:...|.....|..::||...|: |.|.|.|...:          |..|::.:..|   
Human   205 IFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAY----------TVGLLVLAGVA--- 256

  Fly   189 GDFVFRPWRLLLLVSLLPGFIGGLILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQ 250
              :....||.|.....||.|   ..||||   ||||::|:||.||.||:..:..|:|.| |||:.
Human   257 --YALPHWRWLQFTVSLPNF---FFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKN-GKSLP 315

  Fly   251 ---QVLSCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFS 312
               |.|..:|.|.|..:|...:|:...|       |.:.|:.|.     :|:...::...|:.. 
Human   316 ASLQRLRLEEETGKKLNPSFLDLVRTPQ-------IRKHTMILM-----YNWFTSSVLYQGLIM- 367

  Fly   313 SNGMQLWFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTY---IDNLVVGFA 374
                          ..|...::..:....|..||.|.....:...|.| .:.|   ..|:|.|.|
Human   368 --------------HMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRI-GRRYPWAASNMVAGAA 417

  Fly   375 FLIGFSIQG------LILNPLGRKNVLLAALAVATLSGVL---------LHFMESPT---GVLVL 421
            .|....|.|      :|::.|||..:.:|...|..::..|         :|...|..   |::..
Human   418 CLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITP 482

  Fly   422 FCLYIL------LP----GLSISIMIGAIVDLVPTHLRSKAV 453
            |.:|.|      ||    |: :.::.|.:|.|:| ..:.||:
Human   483 FLVYRLTNIWLELPLMVFGV-LGLVAGGLVLLLP-ETKGKAL 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 115/465 (25%)
MFS 34..>189 CDD:119392 38/157 (24%)
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 123/497 (25%)
MFS 124..492 CDD:119392 108/447 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.