DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and Slc22a21

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_062697.1 Gene:Slc22a21 / 56517 MGIID:1929481 Length:564 Species:Mus musculus


Alignment Length:415 Identity:83/415 - (20%)
Similarity:162/415 - (39%) Gaps:99/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |:.|.::|.|.:||..||:.:|...........|:.:|..:..:|.::..|||  :|.:|    .
Mouse   152 GVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEMFTLLYTLVG--MGHIS----N 210

  Fly   144 YLSEFNIPRH---RAVAINYSTM----FVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLL 201
            |::.|.:...   ::|.|.::|:    |.:...:.:|..|:.:              |.||.|||
Mouse   211 YVAAFVLGTEMLSKSVRIIFATLGVCIFFAFGFMVLPLFAYFI--------------REWRRLLL 261

  Fly   202 VSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPV 266
            ...|||.:.|.:..:.||||::|:||.:..||...:...:|.|...:...:.          ||.
Mouse   262 AITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIF----------DPS 316

  Fly   267 GENLLGESQGCGILSKICRATIPLFHKP---HGFNFILC-NLALFGMFFSSNGMQLWFPEIVNRS 327
            ..|.|.:..     ||          ||   |.::.:.. |:.:..:.    .:.||....|.  
Mouse   317 ETNKLQDDS-----SK----------KPQSHHIYDLVRTPNIRILTIM----SIILWLTISVG-- 360

  Fly   328 SGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRK 392
                        ...:.::.||          ::...|::..::....:..:.:..|:|..:.|:
Mouse   361 ------------YFGLSLDTPN----------LNGNIYVNCFLLAAVEVPAYVLAWLLLQHVSRR 403

  Fly   393 NVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSI----SIMIGAIVDLVPTHLRSKAV 453
            ..:..:|.:.  ..|||.....|:.:..|....:::....|    |::.....:|.||.:|:..|
Mouse   404 YSMAGSLFLG--GSVLLLVQLVPSDLHYLSTTLVMVGKFGITSAYSMVYVYTAELYPTVVRNMGV 466

  Fly   454 SFCMSLGRLGIIAATNLMGVMLQPY 478
                     |:.:..:.:|.:|.||
Mouse   467 ---------GVSSTASRLGSILSPY 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 80/410 (20%)
MFS 34..>189 CDD:119392 25/116 (22%)
Slc22a21NP_062697.1 2A0119 12..523 CDD:273328 83/415 (20%)
MFS 123..513 CDD:119392 83/415 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.