DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and SLC22A11

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_060954.1 Gene:SLC22A11 / 55867 HGNCID:18120 Length:550 Species:Homo sapiens


Alignment Length:473 Identity:92/473 - (19%)
Similarity:184/473 - (38%) Gaps:101/473 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YGKTQWVLLLVSGLLTITS-----------VAAQQAMSIIVIASQCEFETTQAEKGVMMAASVTG 79
            :.:.||.||..:...|..|           |..:...:..::|......::|..|.:..:..::|
Human    88 FRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSG 152

  Fly    80 IFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVL-----MFVTSVWLFNIINLLVGISVGAVSA 139
            |.:.::|||.:|...||:.:|.:     ..||..:     :|..:..::..:..:....:..:..
Human   153 ILVGSFIWGLLSYRFGRKPMLSW-----CCLQLAVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFL 212

  Fly   140 ALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMG-DFVFRPWRLLLLVS 203
            :....:.|:.....|||     ||.|...|          .|:..|...| .|..|.||.|.|.:
Human   213 SSLTLMVEWTTTSRRAV-----TMTVVGCA----------FSAGQAALGGLAFALRDWRTLQLAA 262

  Fly   204 LLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGE 268
            .:|.|...||..:.|||.::|:.:.|.::|::.:..:::.|..|..:.:..  |..:.|   |.|
Human   263 SVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVARINGHKEAKNLTI--EVLMSS---VKE 322

  Fly   269 NLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLAL--FGMFFSSNGMQLWFPEIVNRSSGAE 331
            .:....:...:|...|   :|:      ..:..|.:.:  |.:..|..|:               
Human   323 EVASAKEPRSVLDLFC---VPV------LRWRSCAMLVVNFSLLISYYGL--------------- 363

  Fly   332 NNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRKNVLL 396
                 |.::.|                 :....::...:.|....:|.:...|:|:.|||:.:..
Human   364 -----VFDLQS-----------------LGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQA 406

  Fly   397 AALAVATLSGVLLHFMESPTGVLVLFCLYILLP----GLSISIMIGAIVDLVPTHLRSKAVSFCM 457
            .:.|:|.|:  :|..|..|..:..|..::.:|.    |:|::.:.....:|.||.:|..|.....
Human   407 GSQAMAGLA--ILANMLVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILH 469

  Fly   458 SLGRLGIIAATNLMGVML 475
            ::||||.     :||.::
Human   470 TVGRLGA-----MMGPLI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 92/468 (20%)
MFS 34..>189 CDD:119392 29/170 (17%)
SLC22A11NP_060954.1 Sugar_tr 11..523 CDD:331684 92/473 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.