DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and slc22a13b

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_017209322.1 Gene:slc22a13b / 556601 ZFINID:ZDB-GENE-061013-532 Length:549 Species:Danio rerio


Alignment Length:442 Identity:89/442 - (20%)
Similarity:178/442 - (40%) Gaps:118/442 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CEFET-TQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFV----LMFVTS 119
            ||.:. ::|.:.:.||    |:.:...::|.::|..|||...|...|    |||:    :.|..:
Zfish   130 CENKVYSEASQSIYMA----GLLVGALLFGPMADKYGRRFATLLSLF----LQFLSGVGVAFSPN 186

  Fly   120 VWLFNIINLLVGISVGAVSAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNW 184
            ::::..:..:||.::..:|...:...:|:.....||:....|..|.::..:.:...|:.:     
Zfish   187 IYVYIALRFVVGTTISGISINTFVLGTEWCGSAKRALFTILSHCFFAIGLMLLSGVAYGI----- 246

  Fly   185 AITMGDFVFRPWRLLLLVSLLPGFIGGLILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRG 246
                     |.||:|.||...|   .||..:||   |||.::||:|.|.:.|...:...::.|..
Zfish   247 ---------RNWRVLQLVLSAP---VGLFFIYYWILPESARWLLTQGKLDSAKREILKAARINGR 299

  Fly   247 KSIQQVLSCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFF 311
            |..:.:|.    .:::|:....:.:.:....|.|.|  ||.|..      :.:.:.:|..:|:..
Zfish   300 KVSENLLD----KMEAENTAKSSTMIDLFRVGYLRK--RALIMC------YMWFVTSLVYYGVSL 352

  Fly   312 S--SNGMQLW----------FP------EIVNRSSGAENNS------STVCEIL-SVPVEQPNVT 351
            :  :.|:.::          ||      .::.|.......|      .|.|.|: ::|.:.|.|.
Zfish   353 NVGNFGLDIYLTQLIFGMAEFPARLSCFPLIQRFGRRICQSVVLLLGGTACLIIPAIPAKYPIVV 417

  Fly   352 ETLDCTDPISSKTYIDNLVVG-FAFLIGFSI---------------QGLILNPLGRKNVLLAALA 400
            ..:              .|:| |:....|||               .|:.||.:           
Zfish   418 TVI--------------AVIGKFSLAASFSIVYVYTAELYPTVVRQNGVGLNSM----------- 457

  Fly   401 VATLSGVLLHFMESPTGVLVLF--CLYILLPGLSISIMIGAIVDLVPTHLRS 450
            .|.::|:|...:    |:|.::  .:.:::.| |:..:.||:..|:|..|.:
Zfish   458 CARVAGILAPLI----GLLDVYHHAIPMIIYG-SLPFVGGALTFLLPETLNT 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 89/442 (20%)
MFS 34..>189 CDD:119392 26/133 (20%)
slc22a13bXP_017209322.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.