DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and CG7084

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster


Alignment Length:482 Identity:98/482 - (20%)
Similarity:180/482 - (37%) Gaps:119/482 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LTITSVAAQQAMSIIVIASQCEFETTQAEKGVMMAAS---VTGIFL--------STYIWGYISDD 93
            ||.|:.|.|...|.    .:..:|:|.......:.|.   ||.:|:        .::|.|.:.|.
  Fly   136 LTKTTEACQNGWSY----DKTWYESTIPTDHNWVCAKDLFVTNVFVVGRVTEVAGSFILGQMGDS 196

  Fly    94 IGRRRVLLYG-NFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYAYLSEFNIPRHRAVA 157
            .|||.|.... .|.|......:|..:|...|.|::.:||::|.::..:......|.:....|:..
  Fly   197 YGRRFVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGIVGLTVNSLFQSPQIIGMEISREEDRSRI 261

  Fly   158 INYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGFIGGLILLYYPESPK 222
            ..:.:...|:....:|...|      |        .|.|...:.::.:|..:..|...|..|||:
  Fly   262 AFFQSCGWSIGTTLMPLLYW------W--------LRHWDSFMWLTSIPTAMVLLFSKYVIESPR 312

  Fly   223 FLLSQEKNNEAIEAVAWISKFN------RGKSIQQVLSCDEFTLKSEDPVGENLLGESQGCGILS 281
            :|:|:::..|||..:..|:|.|      ..|.:.::.|.|:               :....||.|
  Fly   313 WLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYSRDK---------------QDVTYGIAS 362

  Fly   282 -----KICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQ------------LWFPE-IVNRSS 328
                 ::.|.|..:     ||::.:..::.|.:...|:.|.            :..|. :|.|..
  Fly   363 LFAGWRLARNTTIM-----GFSWCVVAVSYFTLVLFSSRMAGNPFLNFLYQSIVEIPAYVVGRYM 422

  Fly   329 G---AENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLG 390
            |   ....:::|..::|.....|.:..:.|       :.| :||::..|..|.|      ||.|.
  Fly   423 GDTYGRRFTNSVSFLISFVTCLPIIVYSTD-------ERY-ENLMIYLATFIKF------LNALT 473

  Fly   391 RKNVLLAALAV----ATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIVDL-VPTHLRS 450
            ...|.|..|.:    ...:||.|       |.::...:.:|.|.|   :.:|..||: .|.::  
  Fly   474 FFTVNLQCLEIYPTCMRQTGVAL-------GTILANAIGVLAPYL---VYLGTTVDIRAPYYI-- 526

  Fly   451 KAVSFCMSLGRLGIIAATNLMGVMLQP 477
                       ||::.....:|.:..|
  Fly   527 -----------LGVLFLLGGIGALFLP 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 97/478 (20%)
MFS 34..>189 CDD:119392 34/160 (21%)
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 98/482 (20%)
MFS 184..542 CDD:119392 85/428 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.