DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and CG8925

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_650526.1 Gene:CG8925 / 41963 FlyBaseID:FBgn0038404 Length:670 Species:Drosophila melanogaster


Alignment Length:448 Identity:95/448 - (21%)
Similarity:164/448 - (36%) Gaps:93/448 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 MAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAV 137
            :..:..|..||    |:|||..|||..|:......:....:|.|.|||.:|..:.:::|.:...|
  Fly   285 LVGAAAGAVLS----GWISDRFGRRHTLMAFVTIQSVFGGILAFSTSVAMFMSLRVIIGFASMTV 345

  Fly   138 SAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLV 202
            :...:..:.|....:.|.|        :.:..| :|.....|||:..|     ::.|.||.|.|.
  Fly   346 TVVSFVLVVELVSGKWRTV--------IGILNI-LPVAISYVLSAGLA-----YLIRDWRHLQLA 396

  Fly   203 SLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVG 267
            ...|..|...|..:.||||::||:|.:.:|....:...::.| |.| ..:.|....||::..|..
  Fly   397 ISWPWLIMLSIWFWLPESPRWLLAQGRLDELCGLIERAARMN-GTS-ASLPSNYRKTLEAAVPRA 459

  Fly   268 ENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAEN 332
            .....|:. ..:.||...|..|   .|.....:...|.:|       ..:.|             
  Fly   460 VQSPPEAT-TSVESKAVEADAP---DPSASGHVNPLLVVF-------SAKYW------------- 500

  Fly   333 NSSTVCEILSVPVEQPNV--TETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRKNVL 395
              .|.|..|.:.:....:  ..||..:: :....||::.|.|....|...|..|::..:|.:..|
  Fly   501 --RTTCLTLVIWLTLIIIYFGLTLHLSN-LGGNIYINSAVAGTVEAISICISILVVLKVGIRRSL 562

  Fly   396 LAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIVDLVPTHLRSK--------- 451
            :..:.:..|..:..:.:.:.|||:.|..:        ...:|||...::||:...:         
  Fly   563 IGYMLLPGLCCLATNLVSNQTGVIALATI--------AKCLIGANNAIIPTYTAMQYPTIVRNFG 619

  Fly   452 -------------AVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVI 496
                         .|.|...|..:..:...|:|||              |.||..:.|
  Fly   620 VGMGNLASGIALILVPFLWKLEHIDPLLPLNVMGV--------------CGLIGAVAI 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 91/425 (21%)
MFS 34..>189 CDD:119392 28/115 (24%)
CG8925NP_650526.1 MFS 277..667 CDD:119392 95/448 (21%)
MFS_1 277..635 CDD:284993 84/404 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.