DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and CG7458

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster


Alignment Length:422 Identity:94/422 - (22%)
Similarity:165/422 - (39%) Gaps:94/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CEFETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVW--- 121
            ||.|...:..|.:   :..|.|:...:.||.:|..|||.:|......| ||..|:..::|.:   
  Fly   170 CEDEWKLSMVGTI---NNVGQFVGIPLGGYFADRYGRRTMLAVAGSVS-ALMGVIRSLSSNYSMF 230

  Fly   122 -LFNIINLLVGISVGAVSAALY--AYLSEFNI--PRHRAVAINYSTMFVSVTAIYVPATAWL-VL 180
             :|..:::.||       :.|:  |:|....:  |:.|..|....|:|      |....|:| .|
  Fly   231 LVFEFLDMAVG-------STLFPTAFLLAIELVGPKRRVAAATIITIF------YALGEAFLGFL 282

  Fly   181 SSNWAITMGDFVFRPWRLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNR 245
            :|.         .:.||.||.|...|..:..|.|...|||.::||||....:|...:...::.| 
  Fly   283 ASQ---------VQHWRWLLRVLYAPAVLQILFLWILPESVRWLLSQGAEEKASNVLRRAARIN- 337

  Fly   246 GKSIQQVLSCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMF 310
                |:.|        .|:.:.:.|....|.   ||:...:..|:......|:..:.|..|    
  Fly   338 ----QRPL--------PEEQLNDLLTSNRQK---LSQANESQYPIMRAVVFFSLRIANCCL---- 383

  Fly   311 FSSNGMQLWFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAF 375
                   .||...: .:.|...||..                       :....|.:.::.||..
  Fly   384 -------CWFTHTL-IALGLSLNSVN-----------------------LGGNKYTNFMLNGFIQ 417

  Fly   376 LIGFSIQGLILNPLGRK-----NVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSISI 435
            :.|..:..:|::.:||:     ::||.|:.:...:.|.   .::..|.|.||.:..|....|..|
  Fly   418 IPGLLLPLVIMDRVGRRHSLCASMLLCAICMGASAAVP---ADNYAGSLALFLIGKLAITCSFQI 479

  Fly   436 MIGAIVDLVPTHLRSKAVSFCMSLGRLGIIAA 467
            :.....::.||::|:..:|.|..:||:|.:.|
  Fly   480 LYFFTSEIFPTNVRNTLLSLCSMVGRIGSMLA 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 94/422 (22%)
MFS 34..>189 CDD:119392 34/137 (25%)
CG7458NP_649374.1 2A0119 46..554 CDD:273328 94/422 (22%)
MFS 161..544 CDD:119392 94/422 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.