DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and SLC22A

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_649370.1 Gene:SLC22A / 40437 FlyBaseID:FBgn0037140 Length:568 Species:Drosophila melanogaster


Alignment Length:438 Identity:93/438 - (21%)
Similarity:164/438 - (37%) Gaps:94/438 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |.|....|.|:::|..||...:..|......|..:..|..|...|.:...|..::...:.:..:.
  Fly   172 GQFFGIPIGGFVADRYGRSFSIALGGILGAVLGVIRSFSPSYGWFLVFEFLDNMTSSTLYSTCFV 236

  Fly   144 YLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGF 208
            ...|...|:.|.:|.:..|:|.:|..:              .:.|....|..||:||.::..|  
  Fly   237 IGIELVGPKRRVLACSVITVFYAVGEV--------------LLAMSAKAFHDWRILLRITYGP-- 285

  Fly   209 IGGLILLYY----PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGEN 269
              .||||.|    |||.::||||.|...|...:...:..|:.:..:.||  |:..|.:.|.:.::
  Fly   286 --SLILLAYFWILPESVRWLLSQGKEERAKNILRRAAHVNKRELPESVL--DKLVLANRDKLQQS 346

  Fly   270 LLGESQGCGILSKICRATIPLFHKPHGFNFILCNLAL---------FGMFFSSNGMQLWFPEIVN 325
              .||:            .|:......|.:.:.|.:|         :|:  |.|.:.|       
  Fly   347 --SESR------------FPIREAFKNFKWRIANCSLCWIVHVLVYYGL--SLNVVLL------- 388

  Fly   326 RSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLG 390
              .|.:.|:.....::.:|                                 ||.:..||::..|
  Fly   389 --DGDKYNNFAYIALVEIP---------------------------------GFFMPLLIMDRFG 418

  Fly   391 RKNVLLAALAVATLS--GVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIVDLVPTHLRSKAV 453
            |:..|...:..:.|.  |.:....:.|...||||.:..|....|..::.....::.||:||:..:
  Fly   419 RRYSLCGLMLASGLCCIGTIFTGADQPVLQLVLFLVGKLTITASFQVLYFFASEIYPTNLRNSLL 483

  Fly   454 SFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501
            |||..:||.|.:.|.. ..::.:.|.|....:|....||..::..:.|
  Fly   484 SFCSMMGRFGSMLAPQ-TPLLAKYYANAPAMLFAGAAIVSGLLTLFFP 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 87/410 (21%)
MFS 34..>189 CDD:119392 20/109 (18%)
SLC22ANP_649370.1 2A0119 35..540 CDD:273328 93/438 (21%)
MFS 146..530 CDD:119392 92/436 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.