DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and CG10486

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster


Alignment Length:429 Identity:83/429 - (19%)
Similarity:161/429 - (37%) Gaps:98/429 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |..|....:|:.:|..||...|:...|.:..........|..:.|.|...|||.|.......:|.
  Fly   241 GSILGGLAYGHFADHCGRVAALVSSCFLALVGSLATSMSTDFFTFAISRFLVGASYDTCFTMVYI 305

  Fly   144 YLSEFNIPRHRAVAINYS-TMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPG 207
            .:.|:..|::|.:..|.| .:|.|...:.:|   |:.||:.           .||.....:.||.
  Fly   306 LVLEYVGPKYRTLVANLSLALFYSPFTMVMP---WIALSAG-----------NWRRFSSFTSLPI 356

  Fly   208 FIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVL-----SCDEFTLKSEDPVG 267
            .:........|||.::|:|..:.::|:|.:..:.:.|:.:..:::|     ||.:|..:..|  |
  Fly   357 VLAMFSFCLLPESARWLVSVGEIDKALEILKNVIEVNKKQVSKEILDLFEASCTQFYKEELD--G 419

  Fly   268 ENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAEN 332
            .:.               ..:.:|.:.....:::..:.::      ..:.|.:...|..:|..::
  Fly   420 RDF---------------TVLSIFKRKRMARYMILMILIW------MSISLVYDGHVRAASVLDS 463

  Fly   333 NSSTVCEILSVPVEQPN---VTETLD------CTDPISSKTYIDNLVVGFAFLIGFSIQGLILNP 388
            .:..:...::...|.|.   |..|||      |       ::....:.|...|:|.|.|      
  Fly   464 ENIFLFFTIACATELPGNILVILTLDRAGRRWC-------SFFYTSLSGVFSLLGASFQ------ 515

  Fly   389 LGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIVDLVPTHLRSKAV 453
             .|.|:.::|||....|.:               |..|   ||..:      .:::||.:|::.|
  Fly   516 -NRANMRMSALAGRFFSNI---------------CYNI---GLQWA------AEILPTVVRAQGV 555

  Fly   454 SFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIV 492
            :|..::|.:.::        |..|....:....:.||||
  Fly   556 AFIHTMGFVAML--------MSPPVVYLSKKSLSSTLIV 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 77/410 (19%)
MFS 34..>189 CDD:119392 27/110 (25%)
CG10486NP_647998.2 2A0119 104..612 CDD:273328 83/429 (19%)
MFS 231..602 CDD:119392 83/429 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.