DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and CG5592

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster


Alignment Length:458 Identity:99/458 - (21%)
Similarity:155/458 - (33%) Gaps:132/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |..:....:|:|:|..||...|...|..|.....|.:.......|.....:.|:|:......:|.
  Fly   149 GCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYI 213

  Fly   144 YLSEFNIPRHRAVAINYS-TMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPG 207
            ...|....::|.:..|.: |.|.::.|..:|   ||.           :|...||...:|..||.
  Fly   214 LTLENVGIKYRTLVGNLALTFFFTLGACLLP---WLA-----------YVISNWRHYAMVVALPI 264

  Fly   208 FIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGENLLG 272
            ....|..|..||||.:|:|..|.:..||.:...:|.| ||.|                 .|.:..
  Fly   265 VFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKAN-GKII-----------------SEEVWS 311

  Fly   273 ESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAENNSSTV 337
            |.:.|                   :.....|..| |..::|..:...||.:|            |
  Fly   312 EMREC-------------------YELKFANEQL-GKQYTSLDLFKTFPRLV------------V 344

  Fly   338 CEILSVP--------VEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLI--------- 385
            ..||.|.        .....|.|.|| ||                ..|.||:..|:         
  Fly   345 LTILIVTWMTVALAYDAHVRVVEILD-TD----------------IFITFSLSSLVEIPAGIVPM 392

  Fly   386 --LNPLGRKNVLLAALAVATLSGVLL-----HFMESPTGVLVLFCLYILLPGLSISIMIGA--IV 441
              |:.:|||.::.|.:.:...|.:.:     |:..|...:...|.       .:::..:|.  ..
  Fly   393 LLLDRIGRKPMMSAVMLLCAASSLFVGILKGHWNASTAAIAARFF-------ATMAYNVGQQWAS 450

  Fly   442 DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTT------FAMFTCTLIVCI--VIVH 498
            :::||.||.:.         |.||.....||.:|.|...:|      ..||..||:..|  :|:.
  Fly   451 EILPTVLRGQG---------LAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGALIIL 506

  Fly   499 YLP 501
            :||
  Fly   507 FLP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 88/422 (21%)
MFS 34..>189 CDD:119392 23/110 (21%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 99/458 (22%)
MFS 141..509 CDD:119392 97/456 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.