DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and Slc22a5

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_062142.1 Gene:Slc22a5 / 29726 RGDID:3702 Length:557 Species:Rattus norvegicus


Alignment Length:412 Identity:94/412 - (22%)
Similarity:170/412 - (41%) Gaps:96/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |:.:.::|.|.:||..||:.||...........|:.:|..:..:|.::.:|||  :|.:|..:.|
  Rat   152 GVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQLFSVNFEMFTVLFVLVG--MGQISNYVAA 214

  Fly   144 YLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGF 208
            ::....| ..:::.|.::|:.|.:  .|  |..::||      .:..:..|.||:|||...:||.
  Rat   215 FVLGTEI-LSKSIRIIFATLGVCI--FY--AFGFMVL------PLFAYFIRDWRMLLLALTVPGV 268

  Fly   209 IGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEF-TLKSEDPVGENL-- 270
            :.|.:..:.||||::|:||.:..||...:...:|||...:...:....|. .|.|:.|...::  
  Rat   269 LCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGIVAPSTIFDPSELQDLNSKKPQSHHIYD 333

  Fly   271 LGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEI-----VNRSSGA 330
            |..::...|:      ||        .:.||......|.|    |:.|..|.:     ||     
  Rat   334 LVRTRNIRII------TI--------MSIILWLTISVGYF----GLSLDTPNLHGDIYVN----- 375

  Fly   331 ENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRKNVL 395
                   |.:|:. ||.|                         |:::.:    |:|..|.|:..:
  Rat   376 -------CFLLAA-VEVP-------------------------AYVLAW----LLLQHLPRRYSI 403

  Fly   396 LAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSI----SIMIGAIVDLVPTHLRSKAVSFC 456
            .|||.:.  ..|||.....|:.:..|....:::....|    |::.....:|.||.:|:..|   
  Rat   404 SAALFLG--GSVLLFIQLVPSELFYLSTALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGV--- 463

  Fly   457 MSLGRLGIIAATNLMGVMLQPY 478
                  |:.:..:.:|.:|.||
  Rat   464 ------GVSSTASRLGSILSPY 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 91/407 (22%)
MFS 34..>189 CDD:119392 26/109 (24%)
Slc22a5NP_062142.1 2A0119 12..520 CDD:273328 94/412 (23%)
MFS 123..510 CDD:119392 94/412 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.