DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and Slc22a5

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_035526.1 Gene:Slc22a5 / 20520 MGIID:1329012 Length:557 Species:Mus musculus


Alignment Length:414 Identity:91/414 - (21%)
Similarity:167/414 - (40%) Gaps:100/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |:.:.::|.|.:||..||:.||...........|:.:|..:..:|.::.:|||  :|.:|..:.|
Mouse   152 GVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVG--MGQISNYVAA 214

  Fly   144 YLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGF 208
            ::....| ..:::.|.::|:.|.:  .|  |..::||      .:..:..|.||:|||...:||.
Mouse   215 FVLGTEI-LSKSIRIIFATLGVCI--FY--AFGFMVL------PLFAYFIRDWRMLLLALTVPGV 268

  Fly   209 IGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGENLLGE 273
            :.|.:..:.||||::|:||.:..||...:...:|.|...:...:.          ||      .|
Mouse   269 LCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIF----------DP------SE 317

  Fly   274 SQGCGILSKICRATIPLFHKPHGFNFILC-NLALFGMFFSSNGMQLWFPEIVNRSSGAENNSSTV 337
            .|.       ..:|.|..|  |.::.|.. |:.:..:.    .:.||....|.            
Mouse   318 LQD-------LNSTKPQLH--HIYDLIRTRNIRVITIM----SIILWLTISVG------------ 357

  Fly   338 CEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRKNVLLAALAVA 402
              ...:.::.||          :....|::..::....:..:.:..|:|..|.|:..:.|||   
Mouse   358 --YFGLSLDTPN----------LHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISAAL--- 407

  Fly   403 TLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAI-------------VDLVPTHLRSKAVS 454
            .|.|.:|.||:     ||...|:.|...|   :|:|..             .:|.||.:|:..| 
Mouse   408 FLGGSVLLFMQ-----LVPSELFYLSTAL---VMVGKFGITSAYSMVYVYTAELYPTVVRNMGV- 463

  Fly   455 FCMSLGRLGIIAATNLMGVMLQPY 478
                    |:.:..:.:|.:|.||
Mouse   464 --------GVSSTASRLGSILSPY 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 88/409 (22%)
MFS 34..>189 CDD:119392 26/109 (24%)
Slc22a5NP_035526.1 2A0119 12..520 CDD:273328 91/414 (22%)
MFS 123..510 CDD:119392 91/414 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.