DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and UST4r

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_599206.2 Gene:UST4r / 171397 RGDID:620976 Length:552 Species:Rattus norvegicus


Alignment Length:501 Identity:95/501 - (18%)
Similarity:193/501 - (38%) Gaps:122/501 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YGKTQWVLLLVSGLLTITSVAAQQAMSII--VIASQCEFETT-----------QAEKGVMMAASV 77
            :.:.||.||.::.  |.:|:........:  .:..:..|.:|           ||...|...:.:
  Rat    91 FAQPQWHLLDLND--TFSSITEPDTEPCVDGWVYDRSNFHSTTVTEWNLVCESQALNSVTKLSFM 153

  Fly    78 TGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALY 142
            .|.|:...:.|.:||..||:.:|.|........:....|..:::::..:..|.|:|:..::..:.
  Rat   154 IGAFIGGIVNGLLSDRFGRKFILKYALLQMAITETCAGFAPNLFIYCSLRFLAGMSLEPITVNIN 218

  Fly   143 AYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPG 207
            ..:.|:..|:       :.|| |:|......:...::|:..      .|.|:.|..|.|...:|.
  Rat   219 LLMFEWTSPK-------FLTM-VTVLGSCAGSFGGMILAGL------AFQFQNWHHLQLAMSVPI 269

  Fly   208 FIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGENLLG 272
            |...::..:..||.::|:...|..:.::.:..::..|..|.     |.|..|:   :.|..::..
  Rat   270 FFFLILTRWLSESARWLIVINKPQKGLKELKKVAHINGMKK-----SGDNITM---EVVRTSMKK 326

  Fly   273 ESQGCGILSKICRATIPLFHKP------HGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAE 331
            |.:.    :|:..:...|||.|      :..:||.....|.|:     |:.:....:.|.     
  Rat   327 ELEA----AKMRPSPRDLFHTPILRKQIYILSFIRLLFILSGV-----GVAIHLQHLSNN----- 377

  Fly   332 NNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQG-LILNPLGRKNVL 395
                  .|:|.:.:.             :||              |.||:.| .:||.:||:   
  Rat   378 ------IELLQILIS-------------VSS--------------ILFSVIGHFVLNHIGRR--- 406

  Fly   396 LAALAVATLSGV-LLHFMESPTGVLVL-FCLYILLPGL-SISIMIGAI--VDLVPTHLRSKAVSF 455
            :..:.:..|.|: :|..:.:|..:..| |.:.::..|| ::|....::  .:|:||.||:.|   
  Rat   407 ITQMVIMFLRGISILTAIFAPQEMETLRFIMAMMAEGLAALSYAANSLHANELLPTTLRATA--- 468

  Fly   456 CMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501
                  .|:|.....:|..|.|              :|:::..|.|
  Rat   469 ------RGVIGMFGNIGFFLAP--------------LCMMLASYSP 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 90/470 (19%)
MFS 34..>189 CDD:119392 28/167 (17%)
UST4rNP_599206.2 MFS_OAT 109..516 CDD:340932 89/481 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.