DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31103 and LOC101884074

DIOPT Version :9

Sequence 1:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_017208324.1 Gene:LOC101884074 / 101884074 -ID:- Length:363 Species:Danio rerio


Alignment Length:338 Identity:87/338 - (25%)
Similarity:138/338 - (40%) Gaps:39/338 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SVAAQQAMSIIVIASQCEFETTQAEKGVMMAASVT--GIFLSTYIWGYISDDIGRRRVLLYGNFA 106
            |.||..||.|.| .|......|......:.|.||.  |:.:..:.||.:||.:|||:.||.....
Zfish    21 SSAAAPAMRISV-CSAVNIRITIPFLFCVSAGSVVYLGMMVGAFFWGGLSDKVGRRQCLLVCMSV 84

  Fly   107 SNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIY 171
            :....|:..||.....|....:|.|..:|.....:::|.:||.....|...:::..||..|..||
Zfish    85 NGFFAFLSSFVQGYSTFLFCRMLSGFGIGGAVPIVFSYFAEFLAREKRGEHLSWLCMFWMVGGIY 149

  Fly   172 VPATAWLVLSS-NWAITMGD-FVFRPWRLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAI 234
            ..|.||.::.. .|:.:||. :.|..||:.::|...|.....:.|.:.||||:|.|...|::|  
Zfish   150 ASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCAFPCVSAVVALTFMPESPRFYLEMGKHDE-- 212

  Fly   235 EAVAW-------------------ISKFNRGKSIQQVLSCDEFTLKSEDPVGENLL---GESQGC 277
               ||                   :...||.|..:|:....|...:|.:||.:.|.   .|..|.
Zfish   213 ---AWMVLKQIHDTNMRARGEPEKVFTVNRIKIPKQLDELVEMQSESTNPVLKVLFRIKSELHGI 274

  Fly   278 GILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAENNSSTVCEILS 342
            .:....|      :..|...|.:...:..|.:.|...|:.:|||:::.... |:..:|.|....|
Zfish   275 WLTFLKC------WDYPIKDNTVKLAIVWFSLSFGYYGLSVWFPDVIKHLQ-ADEYASRVKIHTS 332

  Fly   343 VPVEQPNVTETLD 355
            ..:|......||:
Zfish   333 EKIEDFTFNFTLE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 87/338 (26%)
MFS 34..>189 CDD:119392 42/147 (29%)
LOC101884074XP_017208324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208328at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.