DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and FGFRL1

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens


Alignment Length:387 Identity:76/387 - (19%)
Similarity:119/387 - (30%) Gaps:154/387 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QLTSWRRRSLLLTIIVVTATVVSLISQEAEAHNQNAPPILYV--------------RERNWRIS- 67
            |.:..|||       |:...|.|.:..:..|.....|.|.::              |::.|.:| 
Human   174 QPSKMRRR-------VIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSL 231

  Fly    68 -----------------------ETEKVGQIIDRVRAE------DPDGDDLIFGIEPRFSLPGGE 103
                                   .|.|| .:|.|.|::      .|....:.||....|... ..
Human   232 KNLRPEDSGKYTCRVSNRAGAINATYKV-DVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCK-VR 294

  Fly   104 NDASPPEKIPFQIDRETGVVTLNESLAGRAGQNFLIYIT-----VTDGSYTAKNEVFIN------ 157
            :|..|  .|.:....|.|....:.|.....||.|::..|     ..||||.  |::.|.      
Human   295 SDVKP--VIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYL--NKLLITRARQDD 355

  Fly   158 -----ILGERENSSGYRPQTSISNVVHNISQFLPRFDQLPGVQSIRNGLPNSRPGGWYPPVPQNN 217
                 .||  .|:.||..:::...|                       ||:.:|.|  |||..::
Human   356 AGMYICLG--ANTMGYSFRSAFLTV-----------------------LPDPKPPG--PPVASSS 393

  Fly   218 ---------IFGPPPFGNNY------------------PPPPPNIPGVR-----GEQSGEEEQP- 249
                     :.|.|. |..:                  |.|.|.:||.|     .::||:::.| 
Human   394 SATSLPWPVVIGIPA-GAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPPGTARDRSGDKDLPS 457

  Fly   250 -------------DEEVTPTTPVRISSTTPKSRTKLTPITANNSTRVESAIPAETTTPSGGH 298
                         :|..:|..|..:....|.:..||.|       ::.:.|...|.|.|..|
Human   458 LAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYP-------KLYTDIHTHTHTHSHTH 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637 29/144 (20%)
STYKc 470..741 CDD:214568
PTKc 474..742 CDD:270623
FGFRL1XP_024309860.1 I-set 56..139 CDD:254352
Ig2_FGFRL1-like 180..261 CDD:143264 14/88 (16%)
Ig 284..378 CDD:325142 23/100 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.