DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and fgfrl1a

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_956670.1 Gene:fgfrl1a / 393347 ZFINID:ZDB-GENE-040128-2 Length:483 Species:Danio rerio


Alignment Length:169 Identity:32/169 - (18%)
Similarity:63/169 - (37%) Gaps:36/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GNNYPPPPPNIPGVRGEQSGEEEQPDEEVTPTTPVRISSTTPKSRTKLTPITANNSTRVESAIPA 289
            ||    |.|:|..::..:....|:..|.......:.:.:.||:...|.|...:|.:..:.:....
Zfish   170 GN----PRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKV 230

  Fly   290 ETTTPSGGHHNNSSSPITIFSLKSGTIPIVVTV--GGFFVAIAVLLAYLCRRR--LCAISRTLKK 350
            |..      ...:|.||.     :||.|:..||  ||       ..::.|:.|  :..:.:.||:
Zfish   231 EVI------QRTNSKPIL-----TGTHPVNTTVDYGG-------TTSFQCKVRSDVKPVIQWLKR 277

  Fly   351 TKEKEELAKKSNQSQLSSTLTDDSRNSMVM---QQWQGP 386
                   .:...:.:.:||:.....:.:|:   ..|..|
Zfish   278 -------VEPGGEGKYNSTIEVGDHHFVVLPTGDVWSRP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568
PTKc 474..742 CDD:270623
fgfrl1aNP_956670.1 I-set 32..111 CDD:254352
IGc2 38..101 CDD:197706
I-set 141..232 CDD:254352 12/65 (18%)
Ig2_FGFRL1-like 151..232 CDD:143264 12/65 (18%)
I-set 245..349 CDD:254352 15/79 (19%)
Ig 255..350 CDD:299845 11/69 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.