DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Fgfrl1

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_954545.1 Gene:Fgfrl1 / 360903 RGDID:735156 Length:529 Species:Rattus norvegicus


Alignment Length:392 Identity:79/392 - (20%)
Similarity:121/392 - (30%) Gaps:152/392 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QLTSWRRRSLLLTIIVVTATVVSLISQEAEAHNQNAPPILYV--------------RERNWRIS- 67
            |.:..|||       |:...|.|.:..:..|.....|.|:::              |::.|.:| 
  Rat   147 QPSKMRRR-------VIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTRLEASEHRKKKWTLSL 204

  Fly    68 -----------------------ETEKVGQIIDRVRAE------DPDGDDLIFGIEPRFSLPGGE 103
                                   .|.|| .:|.|.|::      .|....:.||....|... ..
  Rat   205 KNLKPEDSGKYTCRVSNRAGAINATYKV-DVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCK-VR 267

  Fly   104 NDASPPEKIPFQIDRETGVVTLNESLAGRAGQNFLIYIT-----VTDGSYTAKNEVFIN------ 157
            :|..|  .|.:....|.|....:.|.....||.|::..|     ..||||.  |::.|:      
  Rat   268 SDVKP--VIQWLKRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYL--NKLLISRARQDD 328

  Fly   158 -----ILGERENSSGYRPQTSISNVVHNISQFLPRFDQLPGVQSIRNGLPNSRPGGWYPPVPQNN 217
                 .||  .|:.||..:::...|                       ||:.:|.|  |||..::
  Rat   329 AGMYICLG--ANTMGYSFRSAFLTV-----------------------LPDPKPPG--PPVAHSS 366

  Fly   218 ---------IFGPP-----------------------PFGNNYPPPPPNIPGVRGEQSGEEEQP- 249
                     :.|.|                       | .:..|.|....||...|:||:::.| 
  Rat   367 STTSLPWPVVIGIPAGAVFILGTVLLWLCQTKKKPCAP-ASTLPVPGHRPPGTSRERSGDKDLPS 430

  Fly   250 ------DEEVTPTTPVRI----SSTTPKSRTKL-TPITANNSTRVESAIPAETTTPSGGHHNNSS 303
                  :|..:...|..|    |:..||...|| |.:..:..|..     ...|...||  ..||
  Rat   431 LAVGICEEHGSTMAPQHILAPGSTAGPKLYPKLYTDVHTHTHTHT-----CTHTLSCGG--QGSS 488

  Fly   304 SP 305
            :|
  Rat   489 AP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637 29/144 (20%)
STYKc 470..741 CDD:214568
PTKc 474..742 CDD:270623
Fgfrl1NP_954545.1 I-set 29..112 CDD:400151
Ig strand A' 35..38 CDD:409353
Ig strand B 41..50 CDD:409353
Ig strand C 56..61 CDD:409353
Ig strand C' 64..67 CDD:409353
Ig strand D 72..77 CDD:409353
Ig strand E 78..84 CDD:409353
Ig strand F 91..99 CDD:409353
Ig strand G 102..112 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..152 1/4 (25%)
IgI_2_FGFRL1-like 143..234 CDD:409442 16/94 (17%)
Ig strand B 164..168 CDD:409442 0/3 (0%)
Ig strand C 177..181 CDD:409442 1/3 (33%)
Ig strand E 200..204 CDD:409442 1/3 (33%)
Ig strand F 214..219 CDD:409442 0/4 (0%)
Ig strand G 227..230 CDD:409442 0/2 (0%)
Ig 242..350 CDD:416386 25/114 (22%)
Ig strand A 242..245 CDD:409353 0/2 (0%)
Ig strand A' 249..253 CDD:409353 1/3 (33%)
Ig strand B 261..268 CDD:409353 1/7 (14%)
Ig strand C 272..279 CDD:409353 2/8 (25%)
Ig strand D 304..309 CDD:409353 1/4 (25%)
Ig strand E 317..322 CDD:409353 1/4 (25%)
Ig strand F 330..338 CDD:409353 2/9 (22%)
Ig strand G 341..349 CDD:409353 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.