DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Pvr

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster


Alignment Length:450 Identity:143/450 - (31%)
Similarity:200/450 - (44%) Gaps:140/450 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 AGSSGAPENAFAGEANCD--------------RWEFPRYRLKFFNILGEGAFGQVWRCEATNING 494
            ||.:...|.| .|..|.|              .:||||..||....||.||||.|.:.||..|..
  Fly   896 AGLANFEEGA-VGHINPDLTLDEQAELLPYNREFEFPRENLKLGKQLGAGAFGVVLKGEAKGIRR 959

  Fly   495 NEGITTVAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVHLLGCCTD---KDPTFVILEYVNR 556
            .|..||||||.:|.:|.....:.|:|||::|..|..|:|||:|||..|.   |....||:||...
  Fly   960 EEPTTTVAVKMVKATADNEVVRALVSELKIMVHLGQHLNVVNLLGAVTKNIAKRELMVIVEYCRF 1024

  Fly   557 GKLQTYLRSSRA---------------------------------------------------ER 570
            |.:|.:|..:|.                                                   |.
  Fly  1025 GNIQNFLLRNRKCFINQINPDTDHIDPSIMTQRMSDNYELHRDTNGGGLKYANVGFPIHSYINEP 1089

  Fly   571 HYGNTH----------------------------------------------------------- 576
            |..||.                                                           
  Fly  1090 HNNNTQPPTHRRNSDNDPRSGTRAGRTGSGTATYSYDRQMDTCATVMTTVPEDDQIMSNNSVQPA 1154

  Fly   577 GKSN---------VLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFA 632
            .:||         .:|:.||.|:.:|||:|||||:|:.::|.||||||||:.:|:..|:.|||.|
  Fly  1155 WRSNYKTDSTEAMTVTTVDLISWAFQVARGMDYLSSKKVLHGDLAARNILLCEDNVVKICDFGLA 1219

  Fly   633 RDVITSKIYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADV 696
            |.:.....|::...|||||:|:|.|||.|::||..||:||:||::||:.:|...|||||.. .::
  Fly  1220 RSMYRGDNYKKSENGKLPIKWLALESLSDHVFSTYSDVWSYGIVLWEMFSLAKVPYPGIDPNQEL 1284

  Fly   697 MRKVRDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLLHTEM--DYIEL 754
            ..|:.||||:|||:...:|||.||..||..:|:.||||||:.:....:|..::  .|::|
  Fly  1285 FNKLNDGYRMEKPKFANQELYEIMLECWRKNPESRPLFAELEKRFANMLGEDVASHYLDL 1344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 129/393 (33%)
PTKc 474..742 CDD:270623 127/390 (33%)
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653
Ig 674..739 CDD:143165
IGc2 779..840 CDD:197706
PKc_like 927..1332 CDD:304357 133/404 (33%)
Pkinase_Tyr 935..1329 CDD:285015 129/393 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.