DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Wsck

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster


Alignment Length:496 Identity:105/496 - (21%)
Similarity:182/496 - (36%) Gaps:130/496 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 TTPSGGHHNNSSSPITIFSL------KSGTIPIVVT--VGGFFVAIAVLLAYLCRRRLCAISRTL 348
            |..|.|.|:...:.:..||.      :|..:.:.||  :.|..:.::::..:..|.:.|...|  
  Fly   373 TMYSRGTHDQHVTSLDDFSYATFEKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCRGRR-- 435

  Fly   349 KKTKEKEELAKKSNQSQLSSTLTDDSRNSMVMQQWQGPVAFANRYVPWERDQQMGIATSQLSTGV 413
                                 ||..:.:.|.:|.   |:.        ||:              
  Fly   436 ---------------------LTGGNTHEMTLQT---PII--------ERE-------------- 454

  Fly   414 TNGGVSSPGVPSPGTGEPGSNLGPGCLTGGAGSSGAPENAFAGEANCDRWEFPRYRLKFFNILGE 478
             |.|......|.|.:.|   |..........|....|.||.              ||...:::|:
  Fly   455 -NNGYLVEDDPLPHSPE---NFKQQLQQLVEGYERIPRNAL--------------RLNVNDVIGD 501

  Fly   479 GAFGQVWRCEATNINGNEGIT------TVAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVHL 537
            |.||::       |.|.....      |:.|..| :......:..||.||..:..|:...:::..
  Fly   502 GRFGEI-------ITGKVSTNDFARDCTLHVLCL-DDLNGTTQAQLLRELRQLSQLKRQEHLLDF 558

  Fly   538 LGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGNTHGKSNVLTSCD---LTSFMYQVAKGMD 599
            .|.....|..::|.|. .|..|:..|..||       ....|..|||..   :..::|::|..|:
  Fly   559 YGVSASPDWFYLIFEQ-QRMSLKRKLVESR-------LMAPSPRLTSLSEQLVLQWIYELASAMN 615

  Fly   600 YLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPI-----------RW 653
            ||:|..::||.|.:.::.:|.|...|::.|                 |.||.           ||
  Fly   616 YLSSCQVVHRQLCSHSVFVTSDFKLKLSVF-----------------GPLPYMNIARQQPDHNRW 663

  Fly   654 MATESL-YDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAAD--VMRKVRDGYRLEKPEHCRRE 715
            :|.|.| :.:..|.:||:||...:.||...||.|||....|::  ::..:|...|..:|.:...:
  Fly   664 LAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGD 728

  Fly   716 LYNIMYYCWSHDPQERPLFAEIIQMLDKLLHTEMDYIELER 756
            ||.::..||..:|.||....::...:.:|:.:....:..:|
  Fly   729 LYQLLLNCWQLEPSERSSCEDVAFGVRQLMTSPRHALSFDR 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 72/293 (25%)
PTKc 474..742 CDD:270623 71/290 (24%)
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 72/285 (25%)
PTKc 497..750 CDD:270623 71/285 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.