DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Pdgfrl

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001011921.1 Gene:Pdgfrl / 290771 RGDID:1308028 Length:375 Species:Rattus norvegicus


Alignment Length:380 Identity:77/380 - (20%)
Similarity:111/380 - (29%) Gaps:142/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PPPNIPGVRGEQSGEEEQPDEEVTPTTPVRISSTTPKSRTKLTPI----TANNSTRVESAI---- 287
            ||.|   .|.::.||.             ||..|..|::.|:..|    ||:::.:.:|.:    
  Rat    24 PPKN---KRPKEQGEN-------------RIKPTNKKAKPKIPKIKDRDTADSAPKSQSIMMQAM 72

  Fly   288 -------PAETTTPSGGHHNNS---------SSPITIFSLKSGTIPI---------------VVT 321
                   ||.|.:...|.....         |.|..:.:.|...:.:               ...
  Rat    73 DNGRFQKPAATVSLMAGQSVELRCKGSKVEWSYPAYLDTFKDSRLTVKQNERYGQLTLVNSTTAD 137

  Fly   322 VGGFFVAIAVLLAYLCRRRLCAISRTLKKTKEKEELAKKSNQSQLSSTLTDDSRNSMVMQQWQGP 386
            .|.|.....:...|:|||.......|.....||.||...| .|.......:..|.::|..:...|
  Rat   138 TGEFSCWERLCNGYICRRDEARTGSTYIFFTEKGELFVPS-PSYFDVVYLNPDRQAVVPCRVTAP 201

  Fly   387 VA-------FANRYVPWE-----RDQQMGIATSQLST---GVT-----NGGVSSPG--------- 422
            .|       |..:.:|..     .|.:.|....|..:   ||.     .||.|...         
  Rat   202 SAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSDHQGVVYCKAEAGGKSQISVKYQLLYVE 266

  Fly   423 VPSPGTGEPGSNL--GPGCLTGGAGSS------GAP--ENAFAGEANCDRWEFP----------- 466
            |||   |.|.:.:  ....:.||...|      |.|  |..|       ||.||           
  Rat   267 VPS---GPPSTTILASSNKVRGGDDISVLCTVLGEPDVEVEF-------RWIFPGQKDERPVTIQ 321

  Fly   467 -RYRL------------------KFFNILGEGAFGQVWRCEATNINGNEGITTVA 502
             .:||                  :.|..:..|    .:.|.|.|:.|.   ||||
  Rat   322 DTWRLIHRGLGHTTRISQSVITVEDFETIDAG----YYICTAQNLRGQ---TTVA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 11/51 (22%)
PTKc 474..742 CDD:270623 9/29 (31%)
PdgfrlNP_001011921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..63 14/54 (26%)
Ig 79..143 CDD:299845 9/63 (14%)
IG_like 83..>143 CDD:214653 7/59 (12%)
I-set 272..373 CDD:254352 24/112 (21%)
Ig 293..372 CDD:299845 20/91 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.