DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Kdr

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_037194.2 Gene:Kdr / 25589 RGDID:2965 Length:1343 Species:Rattus norvegicus


Alignment Length:365 Identity:137/365 - (37%)
Similarity:197/365 - (53%) Gaps:67/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 EANCDR-------WEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVD 514
            :..|:|       |||||.|||....||.||||||...:|..|:......|||||.|||.||..:
  Rat   810 DERCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSE 874

  Fly   515 RKDLLSELEVMKSLEPHINVVHLLGCCTDK-DPTFVILEYVNRGKLQTYLRSSRAE--------- 569
            .:.|:|||:::..:..|:|||:|||.||.. .|..||:|:...|.|.||||..|.|         
  Rat   875 HRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRGKRNEFVPYKSKGA 939

  Fly   570 -----RHY------------------------GNTHGKS---------------NVLTSCDLTSF 590
                 :.|                        |....||               :.||...|..:
  Rat   940 RFRSGKDYVGELSVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICY 1004

  Fly   591 MYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPIRWMA 655
            .:||||||::|.||..|||||||||||:::.:..|:.|||.|||:.....|.||.:.:||::|||
  Rat  1005 SFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMA 1069

  Fly   656 TESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADVMRKVRDGYRLEKPEHCRRELYNI 719
            .|:::|.:::::||:||||:|:|||.:||::||||:.. .:..|::::|.|:..|::...|:|..
  Rat  1070 PETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQT 1134

  Fly   720 MYYCWSHDPQERPLFAEIIQMLDKLLHTE-----MDYIEL 754
            |..||..||.:||.|:|:::.|..||...     .|||.|
  Rat  1135 MLDCWHEDPNQRPAFSELVEHLGNLLQANAQQDGKDYIVL 1174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 122/325 (38%)
PTKc 474..742 CDD:270623 120/322 (37%)
KdrNP_037194.2 Ig 224..325 CDD:416386
Ig strand A 224..228 CDD:409353
Ig strand A' 234..238 CDD:409353
Ig strand B 240..249 CDD:409353
Ig strand C 256..261 CDD:409353
Ig strand C' 264..266 CDD:409353
Ig strand D 270..278 CDD:409353
Ig strand E 286..294 CDD:409353
Ig strand F 304..310 CDD:409353
Ig strand G 315..321 CDD:409353
Ig 329..417 CDD:416386
Ig strand A 329..332 CDD:409353
Ig strand A' 339..343 CDD:409353
Ig strand B 345..356 CDD:409353
Ig strand C 360..366 CDD:409353
Ig strand C' 368..371 CDD:409353
Ig strand D 376..379 CDD:409353
Ig strand E 381..386 CDD:409353
Ig strand F 394..402 CDD:409353
Ig strand G 408..417 CDD:409353
Ig_3 547..641 CDD:404760
IGc2 676..740 CDD:197706
Ig strand B 680..684 CDD:409353
Ig strand C 693..697 CDD:409353
Ig strand E 716..720 CDD:409353
Ig strand F 730..735 CDD:409353
VEGFR-2_TMD 755..789 CDD:375470
PTKc_VEGFR2 822..1163 CDD:270681 131/340 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1267..1314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.